(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSN

CR954246.CYSN        Location/Qualifiers
FT   CDS_pept        complement(218836..220260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysN"
FT                   /locus_tag="PSHAa0211"
FT                   /product="ATP-sulfurylase, subunit 1 (ATP:sulfate
FT                   adenylyltransferase)"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.7.7.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1730615, 7487067, 10939241, 12007424; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85314"
FT                   /db_xref="GOA:Q3ILR1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR1"
FT                   /protein_id="CAI85314.1"
FT                   /translation="MANQNNDTFNEVKAIGIDAYLARQQDKSLLRMLTCGSVDDGKSTL
FT                   IGRLLHDSHQIYEDQLAALHKDNEKVGNAGDDLDLALLVDGLQAEREQGITIDVAYRYF
FT                   STAKRKFIIADTPGHEQYTRNMVTGASTSDVAIILVDARYGVQVQTKRHSFICDSLGIK
FT                   QFVVAINKMDIVDFDETVYEKIKADYLKFAEQLNVSNIKFVPMSALKGDNVVTRSVHTP
FT                   YYTDKPLLELLEDSPAAQIDTDFEARLPVQYVARPNLNFRGFQGTLASGKLQVGDAIKV
FT                   LPSGKTSSIKEIVTFDGNLDSAQAGQAITVTLNSEIDISRGDVIVPASSTAIVTNQLQA
FT                   KLVWMHETPLQLGKSYNFKLGSKNTSAQVTKIDHTIDVNTLEHGSSDTLQLNEIAIVTL
FT                   ELSETILADEYHSNHETGSFILIDRLSNLTIAAGMIEQVLQSQAQQSNFSAFEVEFNTL
FT                   VRKHFPHWQALDISKL"
     atggctaatc aaaataacga cacatttaac gaagtaaaag caatcggtat agacgcttac        60
     ctagcacgtc agcaagacaa aagcttatta cgcatgctta cctgtggcag cgtagatgac       120
     ggtaaatcaa cactcattgg ccgcctactg cacgacagcc accaaattta tgaagatcag       180
     ttagcagcgc tacataaaga taacgaaaaa gtaggtaacg caggtgatga ccttgattta       240
     gcattacttg ttgatggcct acaagctgag cgtgagcaag gtattaccat tgacgtagcg       300
     taccgttact tctcgaccgc taagcgcaag tttattattg ccgatacccc agggcacgag       360
     cagtatacgc gcaacatggt aacgggtgca tcaaccagcg atgtggccat tattttggtg       420
     gatgcacgtt acggcgtgca agtacaaact aaacgtcaca gctttatttg tgactcgctt       480
     ggtattaagc aatttgttgt ggctattaat aaaatggata tcgttgattt tgacgaaact       540
     gtttatgaaa aaattaaagc tgattactta aaatttgccg agcaacttaa tgtaagtaac       600
     attaaatttg tacctatgtc ggcgcttaaa ggcgataacg tagttactcg ttctgtacat       660
     acgccttact acaccgataa accattgcta gagttattag aggactcgcc agcagcgcaa       720
     atcgacactg actttgaagc acgtttaccg gtgcaatatg tggcgcgccc taacttaaac       780
     tttcgtggtt ttcagggcac gctagcctca ggcaagttac aagtgggcga tgcaataaaa       840
     gtactaccat cgggcaaaac ttctagcatt aaagaaattg ttacctttga tggcaaccta       900
     gacagtgcac aagctggcca agcaattacc gttacgctaa atagcgaaat tgatattagc       960
     cgaggcgatg tcattgtacc agcaagctct acggcaatag ttaccaacca gctacaagct      1020
     aaattagtat ggatgcacga aacgccgctg caactaggta aaagctataa ctttaaactt      1080
     ggtagcaaaa acacctctgc tcaagttact aagattgatc acactatcga tgtaaatacc      1140
     ttagagcatg gtagcagcga cactctacag ttaaacgaaa tcgctattgt aacgctagaa      1200
     cttagcgaaa ctattttggc tgatgagtat cacagtaatc acgaaaccgg ctcgtttata      1260
     cttatcgatc gcttatctaa cttaactatt gcagccggta tgatagagca agtactgcaa      1320
     agccaagcgc agcaaagtaa ctttagtgct tttgaagttg agtttaacac tttagtacgc      1380
     aagcactttc cgcattggca agcgcttgat atatcaaagt tataa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page