(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSQ

CR954246.CYSQ        Location/Qualifiers
FT   CDS_pept        complement(215671..216378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="PSHAa0208"
FT                   /product="likely to be PAP (3',5' adenosine diphosphate) 3'
FT                   phosphatase"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.5.6 : Pantothenate and coenzyme A"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.4 : Metabolism of lipids"
FT                   /EC_number="3.1.3.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85311"
FT                   /db_xref="GOA:Q3ILR4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR4"
FT                   /protein_id="CAI85311.1"
FT                   /translation="MGIYQKDFNVEYKADESPVTDADLAAHKIIVAGLQQLTPDIPILS
FT                   EENADISWEVRKAWKSYWLVDPIDGTKEFIKKNGEFTVNIALIENGIPVLAVVDAPALG
FT                   VSYLASEAIGAFKDKGDERIELKVTTKPNTGLIRVVGSRSHPSPDLAEFVKRFDEVEMV
FT                   SKGSSLKLCLVAEGSADIYPRLGPTCEWDTGAGHAIAAIAGAKVTKIDGSPLIYNTKDE
FT                   YLNPYFIVSAIEE"
     atgggaattt atcaaaagga ctttaacgtt gaatacaaag ccgatgaaag ccctgtaacc        60
     gacgccgact tagcagctca taaaattatt gtcgcagggc tacagcagct cactcccgac       120
     attcctatat taagtgaaga aaacgctgat ataagctggg aagttcgcaa agcatggaaa       180
     agttactggc tagtagatcc tatcgatggc accaaagagt ttattaaaaa aaatggtgaa       240
     ttcaccgtaa atatcgcact tatcgaaaat ggcattccgg ttttagccgt agtagacgcc       300
     ccagcccttg gcgtatctta cttagcaagc gaagccatag gcgcatttaa agacaaaggc       360
     gatgagcgca tagagctaaa agtaactacc aagccaaaca cagggttaat acgcgtagtt       420
     ggcagccgct cacacccctc acccgattta gccgaatttg taaaacgctt tgacgaggta       480
     gaaatggttt caaaaggcag ctcactaaag ctgtgcttag tggccgaagg cagcgccgat       540
     atttacccac gcttaggccc aacctgtgaa tgggatactg gcgccggcca tgcaatcgcc       600
     gcaatcgccg gcgctaaagt aactaaaatt gatggcagcc cattgatata taacaccaaa       660
     gatgagtatt taaatccgta ttttattgtg agtgcgatag aagagtaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page