(data stored in ACNUC7421 zone)

EMBL: CR954246.CZCA

CR954246.CZCA        Location/Qualifiers
FT   CDS_pept        598495..601632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcA"
FT                   /locus_tag="PSHAa0579"
FT                   /product="Cobalt-zinc-cadmium resistance protein czcA
FT                   (Cation efflux system protein czcA)"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85666"
FT                   /db_xref="GOA:Q3ILG7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG7"
FT                   /protein_id="CAI85666.1"
FT                   /translation="MINWIVSFAVKRRMLVLALTFLFAGFGVYNIQNLAVDAVPDITNV
FT                   QVQINTKAQGFTPLEVEQRITYLVETAMAGIPKLDYTRSLSRYGLSQVTVIFDEGTDIY
FT                   WARQQIGERIQSIRSDLPANIEPNLGPIASGLGEIFTYSVHTEPNTLKDDGTPYNAEDL
FT                   RTLQDWVIRPQLLKVKGVTEINSQGGFERQYQVAPVPEKLIAYKLTISDVISALEVNNS
FT                   NRGAGYIERFDGQYLVRSPGQLKTLEDIANTVVAKRDDAPVRIKDVANVLLGKELRTGA
FT                   ATYNGEETVLGTAMMLIGENSRVVAKAMADKLVDVQKSLPAGVIVEAVYDRTTLVDKTI
FT                   ATVQTNLFEGAVLVIVVLLLLLGNVTGALITAMVIPLSMLFAVTGMVGNRVSGNLMSLG
FT                   AIDFGLIVDGAVIVVENCLRQLGVAQHKHGRLLTLNERLNVVTAATKEVFTPAVFGIVI
FT                   IMLVYLPLFALSGVEGKMFQPMAFTVVAALIGALIFGVTFVPAAIAVFVRGKVNETENA
FT                   VMRGVKKVYKPLLGISLKLPWLMVGIATALVLVLGFKVKNMGAEFLPQLDEGDIAMHAL
FT                   RITGTGIEQSVQMQKELEQAILKQPEVANVFSKIGTADVASDPMPPNVADTFLMLKPQK
FT                   QWPNPALTKEELVQQIRTRVNDVPGNNYEFTQPIEMRFNELIAGVRADVALRIYGDDLS
FT                   VLKEFGEKATGLMRNIAGATDVRLEQMEGLPTLSVTPMRDHMALLGLSVNDIQQTLAAA
FT                   VGGVQTGLIFEGDKRFSLLVRLDKRWSSDVSALARLPVALPKDSNPELAFVPLGEVATI
FT                   SIEKGPNQINRESGKRNVVVTANVEGRDLASFVSDAQASMNESLNLPSGYWLEYGGTFE
FT                   QLQSASKRLSLVVPVTLLLIFGLLYSAFGSLRDSLIIFSGVPLALTGGVLALLLRDMPL
FT                   SISAGVGFIALSGVAVLNGVVMLSFIKQLRDDGLNLIDAINDGALQRLRPVLMTALVAS
FT                   LGFIPMALNSGTGSEVQKPLATVVVGGIISSTLLTLLILPALYKLVHAKFNKYQAA"
     atgattaatt ggatagtttc ttttgcggtt aaacgccgca tgctggtgct tgcgcttaca        60
     tttttatttg ctggatttgg tgtatacaat attcaaaatt tagcggtaga cgcagtaccc       120
     gatataacta acgtacaagt gcaaattaat accaaagcgc aggggtttac gccattagag       180
     gtagagcaac gcattactta tttggtagaa accgccatgg cgggcatacc taagcttgat       240
     tatacccgtt cgctttcgcg ttatgggctt tcgcaagtaa cggttatttt tgatgaaggc       300
     accgatattt attgggcgcg ccagcaaata ggtgagcgta ttcaaagtat tcgctcagac       360
     ttgccagcca atattgagcc aaacttagga ccaattgcta gcggcctagg ggagattttt       420
     acttactctg tgcatacaga gcctaatacg ttaaaagacg atggcacgcc atataacgca       480
     gaagacttac gtactttgca agattgggtt attcgtccgc agcttttaaa agtaaaaggc       540
     gtaaccgaaa taaacagcca aggtggtttt gagcgtcaat accaagtagc gccagtgccc       600
     gaaaaactca ttgcctataa gcttactatt agcgatgtga ttagtgcact tgaggttaat       660
     aacagtaacc gaggcgcagg ctatattgag cgctttgatg ggcaatattt agtacgctcg       720
     ccagggcagc ttaaaacgct agaagacata gccaataccg ttgttgctaa gcgcgacgac       780
     gcacctgtac gcattaaaga tgtggctaac gtgcttttag gtaaagagct tagaactggt       840
     gcggcgactt ataacggcga agaaaccgtg ctaggcaccg ccatgatgct cattggcgaa       900
     aacagccgcg tggtggcaaa agctatggct gataagttag ttgatgtgca aaaaagctta       960
     cccgctggcg ttattgttga agcggtttac gaccgtacta cgcttgttga taaaaccata      1020
     gcaaccgtgc aaaccaactt atttgaaggt gccgttttag tgatagtagt tttgctatta      1080
     ctgctgggca atgtaacggg cgcgcttatt acggcaatgg ttattccgtt gagtatgttg      1140
     tttgccgtta caggtatggt gggtaatcgc gtatcgggta acctaatgag cttaggtgca      1200
     atcgactttg gtttaattgt tgatggcgct gtaattgttg ttgaaaactg cctgcgccaa      1260
     ctcggtgtag ctcagcataa acatggcagg ctacttacct taaatgagcg tctaaatgta      1320
     gtgaccgccg ccaccaaaga agtatttaca ccggctgtat ttggtattgt tattattatg      1380
     ctggtttact tacctttatt tgcactaagc ggcgttgaag gcaaaatgtt tcagccaatg      1440
     gcgtttactg tagttgctgc attaataggc gcgcttatat ttggcgttac ctttgtacct      1500
     gctgctattg cggtatttgt tcgcggtaag gttaatgaaa ccgaaaacgc agtcatgcgc      1560
     ggcgttaaaa aagtgtataa gccattactt ggtatatcgc ttaaattacc gtggcttatg      1620
     gtgggtattg ccactgcatt agtattagtg cttggtttta aagttaaaaa tatgggggca      1680
     gaatttttac cgcagcttga tgagggcgat attgctatgc atgcgctgcg cattactggc      1740
     accggtattg agcaatcggt acaaatgcaa aaagagcttg aacaagccat tttaaagcaa      1800
     cccgaagtcg ctaacgtttt ttcaaaaatt ggtactgctg acgtggcaag cgatcctatg      1860
     ccgccaaacg tagccgatac ttttttaatg ttaaaacctc aaaaacaatg gccaaatcca      1920
     gcactcacta aagaagagtt ggttcagcaa attcgtactc gtgttaacga tgtacccggt      1980
     aataattacg aattcacaca accaatagaa atgcgcttta acgagttaat tgctggtgtg      2040
     cgcgccgatg tagcactgcg tatttacggt gacgacttaa gcgtacttaa agagtttggc      2100
     gaaaaagcca caggcttaat gcgtaatatt gcaggcgcta ccgatgtacg tttggagcaa      2160
     atggaagggt tgccaacgct ttcggtaaca ccaatgcgcg accacatggc gttattaggc      2220
     ttaagtgtaa acgacattca acaaacactt gccgccgctg ttggtggtgt gcaaaccggg      2280
     ctaatttttg agggcgataa acgcttttcg ttattagtgc gccttgataa acgttggtcg      2340
     agcgatgtat cagcacttgc ccgtttgcca gttgctttac ctaaagatag caacccagaa      2400
     cttgcatttg taccgcttgg cgaagtagcg acaatcagca ttgaaaaagg gcctaatcaa      2460
     ataaaccgcg aaagtggtaa gcgcaacgtc gtggtaactg ccaatgtaga ggggcgcgat      2520
     ttagcaagct ttgtaagtga tgcgcaagcg agcatgaatg aatcacttaa cttaccaagt      2580
     ggctattggc ttgaatacgg cggcacgttt gagcagctac aatcggcaag taagcggtta      2640
     tcattagttg tgccggtcac tttactgctt atatttggct tactttatag cgcctttgga      2700
     tcgcttcgag attcgttaat tatatttagt ggtgtgccac tggcattaac gggtggtgta      2760
     cttgcgttat tgctgcgcga tatgccgctt tcaatctcag cgggtgtcgg ctttattgcc      2820
     ctaagtggtg tagcggtatt aaacggcgtg gttatgctgt cgtttattaa gcagttacga      2880
     gatgacggac ttaacttaat agatgcaata aatgatggcg cattacaacg tttacgcccg      2940
     gtattaatga cggcactggt ggcgagctta ggctttatac ctatggcgct taattcgggg      3000
     acgggttctg aagtgcaaaa acctttagca acggtagtgg ttggcggtat tatttcatca      3060
     actttactta cgctgttaat tttgcctgcg ctttataagt tagtgcatgc aaagtttaat      3120
     aagtatcaag cagcttag                                                    3138
//

If you have problems or comments...

PBIL Back to PBIL home page