(data stored in ACNUC7421 zone)

EMBL: CR954246.CZCB

CR954246.CZCB        Location/Qualifiers
FT   CDS_pept        597239..598486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcB"
FT                   /locus_tag="PSHAa0578"
FT                   /product="putative Cobalt-zinc-cadmium resistance protein ;
FT                   (cation efflux system protein)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85665"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG8"
FT                   /protein_id="CAI85665.1"
FT                   /translation="MNKNIIALLVSLSLAGSVLSTDVFASAEHGESGHKETEQHEQKQG
FT                   PHGGFLLVDPKLTLELKLQEFAGDVELRIYAYKQSKPINISDLNITMSLKRLVEAPQNI
FT                   QFAAEGDYLVSTQSINEPHSFVLAVTANYNGESISYEYEQHEGRTTLTERAIERAGIKT
FT                   EIAQSGEVDITDTLFGVIAPTQHGTVEVMAPYTGLISDIFVSIGQSVKKGEALVSITNR
FT                   ETLQNYTIKSPISGVVTEQYLKRGELASTSALMQVVNLDKVWVELSAFPENIEKLAIGQ
FT                   SAKVYDLHHHLNTQGKVFFIAPMMTGGHIARARIELNNPDGHWRPGMHINSDVSVAKIN
FT                   ASVRVKPHAIQEFNGQTSVFVRKNNVFEVRPVTLGAKNSEWVEVLTGLNAGSEYVTDNS
FT                   YVIKADILKSGASHAH"
     atgaataaaa atataattgc attattagta tcactttcac ttgctggcag cgtgttaagc        60
     acagatgtat ttgcctctgc tgagcatggc gagtcaggtc ataaagaaac agaacaacac       120
     gagcaaaagc aaggtccaca cggtggtttt ttattagttg atcctaaatt aacccttgag       180
     cttaaactgc aagaatttgc cggtgatgtt gagctgcgta tatacgctta caagcaaagc       240
     aagccaatta atataagtga tttaaacata acaatgagtt taaaacgatt agttgaagcg       300
     ccgcaaaata tacagtttgc agctgagggc gactaccttg taagcacgca atcaattaac       360
     gaaccgcatt catttgtact tgccgttact gctaattata acggtgagag tattagctat       420
     gagtacgagc aacacgaagg ccgtaccacg ttaacagagc gagctattga gcgcgcaggt       480
     attaaaactg agatagcaca aagtggtgag gtagatatta ccgacacgct ttttggtgtt       540
     attgcgccaa cccagcacgg cacagtagaa gtaatggcgc cgtatacagg attgatcagc       600
     gatatttttg taagcattgg ccaaagcgtt aaaaaaggcg aggcgcttgt aagtatcact       660
     aaccgcgaaa cactgcaaaa ctacaccatt aaaagcccta ttagtggcgt tgtaactgag       720
     caatatttaa agcgtggtga gcttgcaagc accagcgcac ttatgcaagt agttaacctt       780
     gataaagtat gggttgagct gtcggctttt cccgaaaaca ttgaaaagct agccataggg       840
     caaagcgcta aagtgtacga cttgcatcat catttaaata cgcaaggtaa agtgtttttt       900
     atagccccaa tgatgactgg cgggcacata gcccgtgccc gtatagagct taataaccca       960
     gacgggcatt ggcgcccagg catgcatata aatagcgatg taagtgtggc taaaataaat      1020
     gccagcgtgc gggtaaagcc acacgcaatt caagaattta acggtcaaac aagtgtgttt      1080
     gttcgtaaaa ataatgtatt tgaagtgcgc cccgttacct taggtgcaaa aaatagcgaa      1140
     tgggtagaag tactaacagg cttaaacgcg ggtagcgaat acgtaacaga caatagttat      1200
     gtaattaaag ccgatatttt aaaaagcggc gcaagccacg ctcactag                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page