(data stored in ACNUC7421 zone)

EMBL: CR954246.DAPA

CR954246.DAPA        Location/Qualifiers
FT   CDS_pept        complement(188207..189091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="PSHAa0180"
FT                   /product="putative dihydrodipicolinate synthase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="4.2.1.52"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8021219; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85283"
FT                   /db_xref="GOA:Q3IJ34"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ34"
FT                   /protein_id="CAI85283.1"
FT                   /translation="MIKNFNLDDYSVWTALVTPFNQNGTIDYGTLTTLVAEQAAANNAI
FT                   LLLGSTGEGLALTLKEQQAIVEHVCQLSPNVPLMVAVGGMNLKQQLAWVEYCNHLPIHS
FT                   FLLGSPLYAKPGVIGQTHWFESLLNISKHPCMLYNVPGRSAVDIPVATIQNLQQHKNLW
FT                   ALKEASGNIAQFEAYRQAAPNLAIFSGDDALMPYFAQAGAKGLVSVAANAWPLQTHEFV
FT                   QRSLSGQYPNLFTQWSSAISSLFTVANPIPVKVLMHLQGRLTSSYLRPPLTHLELTQTT
FT                   CIEQANNTILSWH"
     atgatcaaaa actttaattt agatgactac tcagtctgga cggcgctcgt tactccgttt        60
     aatcaaaacg gtacaatcga ctatggcacc ttaaccactt tggttgctga gcaagccgct       120
     gccaataatg ctattttatt actaggcagc acaggtgaag gcttagcctt aacacttaaa       180
     gagcaacaag ccattgttga gcacgtgtgc caattatcgc ctaatgtacc cttaatggtg       240
     gctgtaggtg gtatgaacct caaacagcaa ttagcctggg ttgaatactg taaccacttg       300
     cctattcata gctttttact tggctcgccg ctttatgcaa agcccggtgt aattgggcaa       360
     acccattggt ttgaaagcct tttaaatata agtaaacacc cttgtatgct ttataacgta       420
     ccagggcgaa gcgctgtcga tattccagtg gcaaccattc aaaacctaca acaacataaa       480
     aacctatggg cacttaaaga agccagtggc aacattgcgc aatttgaagc ttaccgtcaa       540
     gcggctccta acttagctat ttttagcggc gacgatgcgc ttatgcccta ctttgcccaa       600
     gccggcgcta aagggctggt atcggtagca gctaatgctt ggccgctaca aactcacgaa       660
     tttgtacagc gtagcctaag tggccaatac cctaatttat ttactcagtg gtcaagcgca       720
     atcagtagct tgttcactgt agcaaacccc attcccgtta aagtactcat gcatttacaa       780
     gggcgattaa cgagttcgta tttacgccca ccgttaactc acctcgaatt aacgcaaaca       840
     acgtgcattg aacaagcaaa caacaccatt ttatcttggc attaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page