(data stored in ACNUC7421 zone)

EMBL: CR954246.DAPD

CR954246.DAPD        Location/Qualifiers
FT   CDS_pept        complement(187451..188191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="PSHAa0179"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="2.3.1.117"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 6094577, 2537822; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85282"
FT                   /db_xref="GOA:Q3IJ35"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ35"
FT                   /protein_id="CAI85282.1"
FT                   /translation="MSWLELLNNLESGAVRAASQNESGQWQANVAVKQGILEAFKNGTN
FT                   TEFVGGFVDKHNLAPQQFSATDGVRMVPGGSSVRRGAYVAKGTIIMPPAYVNIGAYIDE
FT                   GTMVDSHALVGSCAQVGKNVHLSAAVQLGGVLEPIGASPVVVEDDAFIGAGCVIVEGVV
FT                   IKKGAVLAPGVRLSATIPVYDCVNERQLDKGEPIPEYAIVIPGSRPASNEWARAQGLSM
FT                   SCALIVKYRDEQSDASLLLEEVLR"
     atgagctggt tagaactatt aaataattta gagtcgggcg cagtacgcgc agcatcacaa        60
     aacgaaagcg gccaatggca ggctaacgtt gcagtaaaac aaggtatttt agaagccttt       120
     aaaaatggta caaacaccga atttgtcggt ggctttgttg ataaacataa cttagcgcca       180
     caacagttta gtgccaccga tggcgtacgt atggtcccgg gtggctcaag cgttcgccgt       240
     ggtgcttatg tagctaaagg cactattatt atgccaccag cgtatgtaaa tattggcgca       300
     tacattgacg aaggcactat ggtagatagt cacgctttag ttggctcgtg cgcgcaagta       360
     ggtaaaaatg tacaccttag cgcagccgtg caacttggcg gtgtgttaga gccaattggt       420
     gccagcccag tggtagttga agatgatgca tttattggcg caggctgcgt aattgttgaa       480
     ggcgtagtaa ttaaaaaagg cgcagtactt gcccctggtg tgcgtttatc ggccacaatt       540
     ccggtttacg actgtgtaaa cgagcgccaa ctagacaaag gcgagccaat tcctgagtac       600
     gctattgtaa taccaggctc tcgccctgct tcaaacgaat gggcgcgtgc acaaggttta       660
     agcatgtcgt gcgcgttaat tgttaagtac cgcgatgagc aaagtgatgc atcattacta       720
     cttgaagagg ttttacgtta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page