(data stored in ACNUC7421 zone)

EMBL: CR954246.DAPF

CR954246.DAPF        Location/Qualifiers
FT   CDS_pept        complement(94850..95680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="PSHAa0092"
FT                   /product="diaminopimelate epimerase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="5.1.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3283102, 3031013; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85201"
FT                   /db_xref="GOA:Q3IEW3"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEW3"
FT                   /protein_id="CAI85201.1"
FT                   /translation="MLVNFSKMHGLGNDFVVIDNITQNVFLSRDQIIKLADRHFGIGFD
FT                   QLLMVEAPYSPDLDFHYRIFNADGTEVEQCGNGARCFARFVRMKGLTNKHKITVSTKSG
FT                   NLTLYIEKDGQVTVNMGHPNFEPSKIPLKATKRELTYIIRTEEHTVFSGAVSMGNPHCV
FT                   LEVDDITTAQVDILGPLLENHERFPQRANIGFMQVISKEHIKLRVWERGVNETLACGTG
FT                   ACAAMVIGFIQNKLISTVQVDLPGGSLQIRWNGEGHPVRMTGPAEHVFDGQVAL"
     atgttagtta atttttccaa aatgcacggc ttaggcaacg actttgttgt gattgataat        60
     attacacaaa acgttttttt gtcgcgagat caaataataa aactggccga tcgccatttt       120
     ggcattggct ttgaccaact gctaatggtt gaagcaccat actcccctga tctcgatttt       180
     cattaccgta tttttaatgc cgatggcacc gaagtagagc aatgcggcaa tggcgcacgt       240
     tgctttgccc gctttgtacg tatgaaaggc cttaccaata aacacaaaat tactgtgtct       300
     actaagtcgg gtaatttaac cctatacata gaaaaagacg gccaagtaac tgtaaatatg       360
     ggccatccta attttgagcc aagtaaaatc ccactcaaag caaccaagcg cgaactgacc       420
     tatattattc gtaccgaaga gcatactgtt tttagtggcg cggtttctat gggtaaccca       480
     cattgtgtat tagaagttga cgatattact accgcacaag ttgatatttt gggtccgtta       540
     cttgaaaacc atgagcgttt tccgcagcga gctaatattg gttttatgca agttatttcc       600
     aaagagcata ttaaattacg agtgtgggag cgcggtgtaa acgaaacatt agcatgtggt       660
     acaggcgctt gtgcagcaat ggttattggg tttattcaaa ataaattaat cagcacagta       720
     caagtagact tacccggtgg cagtttacaa attcgctgga acggtgaagg tcacccagta       780
     cgtatgaccg gcccagcaga gcatgtgttt gatggacaag tagcactatg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page