(data stored in ACNUC7421 zone)

EMBL: CR954246.DBPA

CR954246.DBPA        Location/Qualifiers
FT   CDS_pept        113841..115229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="PSHAa0109"
FT                   /product="putative ATP-dependent RNA helicase; putative
FT                   cold-shock protein; could be specific for rRNA folding"
FT                   /function="3.2.2 : Processing and degradation of RNA"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12460566; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85218"
FT                   /db_xref="GOA:Q3IDJ4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ4"
FT                   /protein_id="CAI85218.1"
FT                   /translation="MTTTAFSSLALPSGLVDNLSTLGYTHMTPVQAQSLPPVLAGKDII
FT                   AQAKTGSGKTAAFSLGVLAKLNVKRFRIQSLVLCPTRELAEQVAVEMRKLARGIHNIKI
FT                   LTLCGGVSIGPQIGSLEHGAHIIVGTPGRVDDHIRKGTLRLDDVETLVLDEADQMLDMG
FT                   FQDTLDAIIERIPTNRQTLLFSATFPRAIEAVAKRVLSNPVMVKVEEEQAKSTIKQYFY
FT                   KMDNNKQRYPTLKLLLLKFTPQSCVVFCNTKVETQQLCDDLVDEGFSAVSLHGDLEQRD
FT                   RERTLIHFSNKSASILVATDVAARGLDIDDMDMVINYHLAHDTQTHVHRIGRTGRAGKK
FT                   GIACSIYGEAEAFKIAQIGDHYERDVIPEPMPSFSLLEKPPYKPEMVTLMLDSGKKQKV
FT                   RAGDILGALTGKDGIAGRQVGKINVLDNVAFVAVERNSSKPALRKLTEGNIKGRKIRAR
FT                   RLTC"
     gtgaccacaa ctgctttttc atctttggct ttaccttctg ggttagttga taacttatca        60
     acactcggct acacccacat gacacctgtt caggcgcaaa gtttaccgcc agtactggct       120
     ggaaaagaca ttattgctca agcaaaaacg gggtcaggta aaactgcggc gtttagctta       180
     ggcgtattgg ctaaattaaa cgtaaaacgt tttcgcattc aatctttagt attgtgccca       240
     acacgtgagt tggcagagca agtagctgta gaaatgcgca aattagcgcg tggcatccat       300
     aatattaaaa tacttacttt atgtggtggt gtatcaattg gtccacaaat tggctcactt       360
     gaacatggcg cacatattat tgttggtaca ccggggcgag ttgacgatca tattcgtaaa       420
     ggtactttgc gtttagatga tgtagaaacg ctcgtactag atgaagccga ccaaatgcta       480
     gatatgggtt ttcaagatac cttagatgca attattgagc gcattcctac taaccgccaa       540
     acattactat ttagcgctac gtttccacgt gcaatagaag ctgttgcaaa gcgtgtgctt       600
     agcaatccag taatggttaa ggtagaagaa gagcaagcta aaagcactat taagcaatac       660
     ttctataaaa tggataacaa taaacaacgt tacccaacac ttaaattatt gctgcttaaa       720
     tttaccccgc aaagctgtgt cgtgttttgt aatactaaag tagaaacaca gcaattgtgt       780
     gatgatttag ttgatgaagg ctttagtgcg gtatctttac atggtgattt agagcagcgt       840
     gatcgtgagc gtacgttaat tcatttttct aataaaagtg catcaatact agtggcaacc       900
     gatgtggccg cgcgtggttt agacattgac gatatggata tggtgattaa ctatcactta       960
     gctcacgaca cacaaacaca tgtgcatcgt attggtcgta ccggtcgagc gggtaaaaag      1020
     ggtattgcat gctctattta tggtgaggca gaagcattta aaattgcaca aattggtgac      1080
     cattatgagc gcgatgtgat cccagagcca atgccatcgt ttagcttatt agaaaaacca      1140
     ccatacaaac cagaaatggt aaccttaatg cttgattctg gtaaaaagca aaaagtacgc      1200
     gcaggtgata ttttaggtgc acttaccggt aaagacggta ttgcggggcg tcaagttggt      1260
     aaaataaacg tactcgacaa cgttgcgttt gttgccgtag agcgtaattc ttcaaaaccg      1320
     gcactgcgta aattaaccga aggcaatatt aaaggccgta aaatacgcgc tcgtcgcctt      1380
     acgtgctaa                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page