(data stored in ACNUC7421 zone)

EMBL: CR954246.DCDA

CR954246.DCDA        Location/Qualifiers
FT   CDS_pept        complement(186246..187451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcdA"
FT                   /locus_tag="PSHAa0178"
FT                   /product="diaminopimelate decarboxylase, PLP-binding"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="4.1.1.20"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11856852; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85281"
FT                   /db_xref="GOA:Q3IJ29"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ29"
FT                   /protein_id="CAI85281.1"
FT                   /translation="MSFLSTGVKTAINELSSQLDSPFFVYDLDTLNSHLAQLVAQTEVK
FT                   LWYAVKANPLSKIIQCLDNAGFNFDVASKGELEQVLAQGVSSDRVLNTGPAKSPKQIKH
FT                   FIERGVRTFVAESINQVRWLNEQAKLQNCQLQVLLRVQLRWPEGEKNPLGGDSLTPFGL
FT                   GCTEWQALNITDYDALSFDGLHIFQWGNMLSTQKLSELWSQMIAPLSQLARDLNINLKI
FT                   LDLGGGLGIPYTQNDITLNWDDLITALAKIKKQAGVEELWMELGRYAVGECGHYAAPVV
FT                   ERKQNYGQQQVILSGGINHLLRPAVTSQDFPAALLRDSHTPTQAMSLYGPLCTALDSLG
FT                   EHALPSDLNEHDWLVFSQCGAYGFSESMPYFLCHELAGEYVLEQNKLSCLRAAEDASYY
FT                   LR"
     atgagctttt tgagcacggg cgttaaaacg gcaattaatg aattatcaag ccaactcgat        60
     agcccatttt ttgtttacga cctagatacg ctaaatagtc atttggcaca attggtcgca       120
     caaaccgagg taaaactttg gtatgcggtt aaagcgaatc cgctgtctaa aattattcaa       180
     tgcttagata acgccgggtt taattttgac gtagccagta aaggcgagct tgagcaagta       240
     cttgctcaag gcgttagtag cgatcgcgtg ctcaacaccg ggccagctaa aagcccaaaa       300
     caaattaaac actttattga gcgcggcgta cgtacttttg ttgccgaaag tattaatcaa       360
     gttcgctggc tcaatgaaca agccaagcta caaaactgtc aactacaggt attactgcgc       420
     gtacagttac gttggcccga gggcgaaaaa aatccactag gtggcgatag cctcacgcca       480
     ttcggactcg gttgtacaga gtggcaggca cttaatatta ccgactatga cgcacttagc       540
     tttgatggcc tgcatatttt tcaatgggga aatatgctca gcacgcaaaa actcagtgag       600
     ttgtggtcac aaatgattgc accacttagc caacttgccc gcgatttaaa tataaacctt       660
     aaaattttag atttaggtgg cggcttaggt attccgtata cgcaaaacga cataacgctt       720
     aattgggatg acttaataac tgccctcgct aaaattaaaa aacaggcggg cgttgaagag       780
     ttatggatgg agcttggccg ctatgccgtg ggtgaatgcg gacattacgc agccccagta       840
     gtagagcgca aacaaaacta tggccaacaa caagttattt taagtggcgg tataaaccac       900
     ttattgcgcc cagccgtcac cagtcaagac tttccagcag cattactacg agattcacac       960
     acaccaaccc aagctatgag cttatacggg ccactttgta ccgcactcga tagcttgggc      1020
     gagcacgcat taccaagtga tctcaatgag cacgactggt tggtgtttag tcaatgtggt      1080
     gcctatggtt ttagtgaaag tatgccgtac tttttatgcc acgaacttgc tggcgaatat      1140
     gttttagaac aaaacaaact tagctgtttg cgtgcagccg aagatgccag ttattacttg      1200
     agataa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page