(data stored in ACNUC7421 zone)

EMBL: CR954246.DEF

CR954246.DEF         Location/Qualifiers
FT   CDS_pept        complement(26385..26888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="PSHAa0023"
FT                   /product="N-terminal methionine peptide deformylase"
FT                   /function="3.3.6.2 : Chemical modifications"
FT                   /EC_number="3.5.1.88"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9374870; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85137"
FT                   /db_xref="GOA:Q3IDI2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDI2"
FT                   /protein_id="CAI85137.1"
FT                   /translation="MATLEVLRFPDERLRTIAQEVAHVDDQVRVIIKDMLETMYDENGI
FT                   GLAATQVNIHQRIVVIDVSEERNEPLVLINPQIIKKDGTTVSEEGCLSVPNSYAKVDRA
FT                   ETVTVAALNEQGEEFVLDADELLAICIQHELDHLQGKLFIDYLSPLKRQRIRKKLEKEA
FT                   KFAE"
     atggctacgt tagaagtttt aagattccca gatgaacgtt tacgtacaat agcacaagaa        60
     gttgcacatg ttgacgacca agtccgtgtg attataaaag acatgctaga aactatgtat       120
     gatgaaaatg gcattggtct tgctgccaca caagttaata ttcatcaacg cattgtagtg       180
     attgacgtat cagaagagcg caacgaacca ctggtattaa ttaatccaca aatcattaaa       240
     aaagacggta caaccgtaag cgaagaaggc tgcctttctg tgcctaactc ttacgcaaaa       300
     gttgatcgcg cagaaacggt tactgttgcc gcgcttaacg agcaaggcga agaatttgta       360
     ctagatgcag atgaactact agctatttgt attcaacacg aactagatca ccttcaaggt       420
     aagcttttca ttgattactt atcgccatta aagcgccaac gtattcgtaa aaagcttgaa       480
     aaagaagcca aatttgcaga atag                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page