(data stored in ACNUC7421 zone)

EMBL: CR954246.DIPZ

CR954246.DIPZ        Location/Qualifiers
FT   CDS_pept        275826..277637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dipZ"
FT                   /locus_tag="PSHAa0263"
FT                   /product="thiol:disulfide interchange protein[Precursor]
FT                   (Protein-disulfide reductase) (Disulfide reductase) (C-type
FT                   cytochrome biogenesis protein cycZ) (Inner membrane copper
FT                   tolerance protein)"
FT                   /function="1.4.2 : Electron transport"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="1.8.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7623667, 7628442; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85362"
FT                   /db_xref="GOA:Q3IDT3"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT3"
FT                   /protein_id="CAI85362.1"
FT                   /translation="MRFFFLLLVALLAAPAKANNILGDLLAPPQQTFLQVDQAFVFDFD
FT                   QQDNTLFIGWDIAPEYYLYKNKIEIIAKGANIEVGDLGNGEVIEDEFFGKTEVFFNALS
FT                   IVSKLSNVTEGAVVKVRYQGCAEAGLCYPPEVISIPLNKIAGEQLQNADDATHSATSAN
FT                   AFTALSQANAPTSNAPKKDLTFTEQLASQGLITNLLIFFVVGVGLAFTPCVFPMFPILS
FT                   SLIAGQKNLSTKKAFALSFVYIQGMAVTYAALGLVVAALGGQVQGYLQHPYVLISFSLL
FT                   FVLLAMSMFGWYEIKLPSGMMNKLTQVSNNQKGGNYVGVFLMGVLSGLIASPCTTAPLS
FT                   AALLFVAQSGDYLVGGLTLYVLSLGMGLPLLLLGTSGGKLLPKAGGWMEQVKTLFGFIM
FT                   LVVPLILLERLLDADVILLMAGVLALATALYLHHWQSSQTQGKLKTALWFAATLLVVSG
FT                   FNLTKNYFWPVHMQTMQVSAQSNEFKQVANLTELKAAVAHANEQGRLVMVDLYADWCIA
FT                   CKEFEHYTFPDAKVQNEFSHFELIQVDLTDSDNKTIELMEEYTVFGLPSILFFNTQGEE
FT                   LSAQRVTGFLNAEDFAQHLSTVRASVK"
     atgcgttttt tctttttgtt actggttgca ttattagcgg ctccagctaa ggctaataat        60
     atacttggtg atttacttgc acctccacaa caaacctttt tacaagtaga ccaagcattt       120
     gtatttgatt ttgatcagca agataatact ttatttatag gctgggatat tgcacctgaa       180
     tactacttat ataaaaataa aatagagatt attgccaaag gcgcgaatat agaagtaggc       240
     gacttaggta atggagaagt tatcgaagat gagttctttg gtaaaacaga agtttttttt       300
     aatgcactta gtattgttag taagctcagt aatgtaactg agggagcagt agtaaaagtg       360
     cgttaccaag gttgtgctga agctgggtta tgttacccac ctgaagttat tagtattccg       420
     ctaaacaaaa ttgccggtga acagctgcaa aatgctgatg atgctacgca cagtgcaacc       480
     tctgcaaacg catttacagc attaagtcag gctaatgcgc cgacaagcaa tgcgcctaaa       540
     aaagatctga cctttaccga gcagttagca agccaagggc taattactaa tttactgata       600
     ttttttgttg ttggtgttgg cctggctttt acaccgtgtg tatttccaat gtttccaatt       660
     ttgtcgagct taattgctgg gcaaaaaaat ctctcaacta aaaaagcctt cgcgttatca       720
     tttgtatata ttcaaggtat ggcagtgacc tacgcggcat taggtttggt tgtggccgca       780
     cttggcgggc aagttcaagg ttatttgcag cacccttatg tacttattag ctttagttta       840
     ttgtttgtat tattagcaat gtcgatgttt ggttggtacg aaataaagct accaagtggc       900
     atgatgaaca agttaaccca agtaagtaat aaccaaaaag gtggcaacta cgttggtgtg       960
     tttttaatgg gcgtattatc gggcttgatt gcctcgcctt gcaccaccgc acctttgtca      1020
     gcggcgctat tgtttgtagc acaaagtggc gactatttag tggggggatt aacgctttat      1080
     gtactgagtt tagggatggg actgccatta ttgttactcg gtacatcggg cggaaaacta      1140
     ttgcctaaag ccggtggctg gatggaacaa gttaaaaccc tatttggctt tattatgcta      1200
     gttgtgccac ttatattact tgagcgcctt ttagatgccg atgttatttt attaatggcg      1260
     ggagtattgg ccttggcaac cgcgctttac ttgcatcact ggcaaagtag ccaaacacaa      1320
     ggaaaattaa aaacagcact gtggtttgct gcaacgttac tcgttgttag tggctttaac      1380
     ttaactaaaa attatttttg gccagtacac atgcaaacaa tgcaagtaag tgcgcaaagt      1440
     aatgagttta agcaagtagc caatttaact gagttaaaag cagccgttgc tcacgctaat      1500
     gagcaaggcc gactggttat ggtcgactta tatgctgatt ggtgtattgc gtgtaaagaa      1560
     tttgagcatt acacctttcc cgatgcaaaa gtgcaaaatg agtttagtca ctttgagctt      1620
     attcaagtcg atttaaccga cagcgataac aaaacaatcg aactaatgga agaatatacg      1680
     gtgtttggtt taccgagtat tttgtttttt aatacccaag gagaggagct aagtgcacaa      1740
     cgtgttaccg gctttttgaa tgctgaagat tttgctcagc acctatctac agtacgcgcc      1800
     agcgtaaagt ag                                                          1812
//

If you have problems or comments...

PBIL Back to PBIL home page