(data stored in ACNUC7421 zone)

EMBL: CR954246.DNAA

CR954246.DNAA        Location/Qualifiers
FT   CDS_pept        118..1542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PSHAa0001"
FT                   /product="DNA replication initiator protein,
FT                   transcriptional regulator of replication and other genes;
FT                   binds DNA at DnaA boxes, binds cardiolipin and other acidic
FT                   phospholipids, binds ATP"
FT                   /function="3.1.1 : DNA replication"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12742018, 12864864, 12941279, 14523560; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85115"
FT                   /db_xref="GOA:Q3IDF0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF0"
FT                   /protein_id="CAI85115.1"
FT                   /translation="MMCGNKNYISGSLTVYLSVWQSCLYVLQDELPSQQFSMWVRPLQA
FT                   ESTEDTLTIYAPNRFVLDWVREKYLNRINELLVEICGVEAPELRFDVGSKPLLNAQPVS
FT                   VAGTQSAPTTQAKQQSRQPKPVVEPAPKSEYKSNIKENYTFDSFVEGKSNQLAKAAATQ
FT                   VADNPGAAFNPVFIYGGTGLGKTHLLHAVGNGILANKPDAKIVYMHSERFVQDMVKALQ
FT                   NNAIEEFKRYYRSVDALMIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKE
FT                   IEGVEDRLKSRFGWGLTIAIEPPELETRVAILMKKAQQSKINLPHEVAFFIAKKLRSNV
FT                   RELEGALNRVIANANFTGRPISIDFVKEALRDLLALQDKLVTIDNIQRTVAEYYRIRIS
FT                   DLLSKRRSRSIARPRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKVKSLRDES
FT                   HEIKEDYQNLIRTLSS"
     atgatgtgcg ggaataaaaa ttatatctct gggagtttga ctgtgtatct gtcggtttgg        60
     caaagttgtt tatatgtatt gcaagatgaa ttgccttcgc agcagttcag tatgtgggtg       120
     cgaccactac aagcagaaag taccgaagat accttgacga tttatgcacc taatcgcttt       180
     gtactagatt gggtaagaga aaaataccta aatagaatta atgaattatt agtagagatt       240
     tgtggtgttg aagctccaga gctacgtttt gatgtaggca gtaagccttt attaaatgca       300
     cagcctgtat ctgttgctgg aacgcaatcg gcgccaacta cacaagccaa acaacaatca       360
     cgacaaccaa aacctgttgt agagccagcg ccaaaatctg aatataaatc gaatataaaa       420
     gaaaattata cctttgacag ttttgttgaa ggtaaatcaa accagttagc aaaagcagca       480
     gcaacacaag ttgcagataa tccaggtgcc gcttttaacc ctgtatttat atacggtggt       540
     acaggtttag gtaaaacgca tttattgcat gctgtaggta atggtatttt ggctaataag       600
     ccagatgcaa aaatagttta tatgcattca gagcgctttg tacaagatat ggtaaaagca       660
     ctgcaaaata acgcgattga agaatttaag cgttactatc gtagtgttga tgcgctaatg       720
     attgatgaca ttcaattttt tgctaacaaa gagcgctcac aagaagagtt ttttcatacc       780
     tttaatgcgt tattagaagg caatcagcaa ataattttaa cctctgaccg ttatccaaaa       840
     gagatagaag gcgttgaaga cagacttaaa tcgcgttttg gttggggttt aactattgca       900
     attgagcctc ctgagcttga aacacgcgtt gctatattga tgaaaaaagc gcagcagagt       960
     aaaattaatt taccgcacga agtcgccttt tttattgcta aaaaattacg atctaatgta      1020
     cgcgaactag aaggtgcgct taatcgtgtt attgccaatg ctaactttac cggtcgtcct      1080
     atatctatcg actttgtaaa agaagcgcta cgcgatttac ttgccttaca agataagcta      1140
     gttaccatag ataacataca gcgcactgtg gcagagtatt acagaattcg tatttctgat      1200
     ctgctgtcta aacgccgtag tcgctctata gcaaggcctc gacaagttgc tatggcatta      1260
     tctaaagagt taaccaatca cagtttacct gagattggag acgcctttgg tggccgcgat      1320
     catacaactg tattgcatgc gtgtcgtaag gttaaatcac tacgtgatga aagccacgaa      1380
     attaaagaag attaccaaaa tttaataaga acattgtcat cttaa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page