(data stored in ACNUC7421 zone)

EMBL: CR954246.DNAG

CR954246.DNAG        Location/Qualifiers
FT   CDS_pept        complement(363807..365558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="PSHAa0350"
FT                   /product="DNA primase"
FT                   /function="3.1.1 : DNA replication"
FT                   /EC_number="2.7.7.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 6186393; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85448"
FT                   /db_xref="GOA:Q3IIB8"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB8"
FT                   /protein_id="CAI85448.1"
FT                   /translation="MAGKIPRNFIDDLLARTDIVDLIDSKVGLKKAGKDYQACCPFHNE
FT                   KSPSFTVSQDKQFYHCFGCGVNGNAISFVMEYEKLEFVDAIEELASLLNLEVPREQGSG
FT                   SAPERTAAQKRSDYDLMLHTARFYQHQLKHHSNSAAVIEYVKGRGLSGEIVKKFMIGYA
FT                   PSEWDGLCLQLGRNKEQKEQLVELKLASEKTPGRQFDFFRDRLMFPIRDKRGRVVAFGG
FT                   RVMQADQGPKYLNSPETRIFHKGFELYGLYEAKQAHKKLDHVLIVEGYMDVVALAEQGI
FT                   EYAVAALGTATTSEHMHTLFRTTDKVICCYDGDRAGRDAAWRALENALPYLNDGKALNF
FT                   VFLPDGEDPDSLVQAEGKDKFEQRLNAADDFTKVLFNKLSLEIDLTLDSGKAKLLSAAL
FT                   PLIEKIPSEFYQENILEQLGRLIGRTREQLNNRLKTPKQQHSIERKFKITPMRQAIGIL
FT                   IQHPQMAKSVPYLPDLAQMNIAGIGLLLRLQHQALQKEDVTTAQLLEFFRGTDDYDPLT
FT                   KLATWQHQINEERLETVFQNTFKFIEDQCLNYRLETLLIKDKTQGLNSDERLECHLLMT
FT                   ALKATNS"
     atggctggaa agatcccacg taattttatt gatgacttgc ttgccagaac cgatattgtc        60
     gacctgatag actcaaaagt cggtcttaaa aaagccggta aagactacca agcttgctgc       120
     ccttttcata acgaaaaatc gccttcgttc accgtctccc aagataaaca gttttatcac       180
     tgctttggct gtggcgttaa cggtaatgct atttcgtttg ttatggaata cgaaaaactt       240
     gagtttgttg atgctattga agagcttgca agtttactta atttagaagt tccccgtgag       300
     caaggtagcg gctcggcacc tgagcgtact gcagcgcaaa aacgctctga ttacgattta       360
     atgctccata ctgcaaggtt ttatcaacac cagttaaagc accatagtaa ttctgccgct       420
     gttattgaat acgttaaagg ccggggctta agcggcgaaa tagttaaaaa gttcatgata       480
     ggttatgcac caagtgaatg ggatggtttg tgcctacaac ttggccgtaa caaagaacaa       540
     aaagagcaat tggtagagct aaaactcgcc tcagaaaaaa cacctggcag acagtttgac       600
     ttttttcgcg atcgattaat gttccctatt cgcgataaac gtggccgcgt agttgccttt       660
     ggtgggcgcg taatgcaagc cgatcaaggc cctaaatatt taaactcgcc agagacacgt       720
     atttttcata aaggctttga actctatggt ttatatgaag ctaaacaagc acacaaaaag       780
     ctcgaccatg tactgattgt tgaaggctat atggatgtgg tggcgctggc agagcaaggt       840
     attgaatatg ccgttgcagc acttgggaca gcaacaacca gtgagcatat gcacactcta       900
     tttagaacaa cagataaagt aatttgttgt tacgatggtg accgtgcagg gcgtgatgca       960
     gcttggcgtg cgctcgaaaa cgcactgcct tatttaaatg atggtaaagc attaaacttt      1020
     gtatttttac ccgacggcga agaccccgac tccttagtac aagccgaagg taaagataag      1080
     tttgaacaac gcttaaatgc agccgatgat ttcactaaag tgttattcaa taagctcagc      1140
     ctagaaatag atttaacgct tgattcgggt aaagccaagt tacttagtgc cgcattacca      1200
     ttaattgaaa aaattcctag tgagttttat caagaaaata ttcttgagca gctcgggcga      1260
     ttaattggcc gtactcgtga gcaactcaat aatcgcttaa aaacacctaa gcaacagcat      1320
     tcaattgagc gaaaatttaa aataaccccc atgcgccaag caatcggtat tttaattcaa      1380
     catccgcaaa tggctaaaag cgtgccctat ttgcccgatt tagcacaaat gaatattgcc      1440
     ggcattggtt tgctactgcg cttacaacat caagcgttgc aaaaagaaga tgttaccaca      1500
     gcgcagttgc tcgaattctt tagaggcact gacgattatg acccgctaac taagctggca      1560
     acgtggcaac atcaaataaa tgaagagcgt ttagagactg tttttcaaaa tacttttaaa      1620
     tttattgaag atcagtgttt aaattatcga ctagagaccc tattaataaa ggataagacg      1680
     caaggtctaa atagcgatga aagacttgaa tgtcatttgt taatgacagc gttaaaagcg      1740
     actaacagct ag                                                          1752
//

If you have problems or comments...

PBIL Back to PBIL home page