(data stored in ACNUC7421 zone)

EMBL: CR954246.DNAN

CR954246.DNAN        Location/Qualifiers
FT   CDS_pept        1556..2659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PSHAa0002"
FT                   /product="DNA polymerase III, beta-subunit; processivity
FT                   clamp of DNA polymerase III"
FT                   /function="3.1.1 : DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12028381, 12100549, 12511510; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85116"
FT                   /db_xref="GOA:Q3IDE9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE9"
FT                   /protein_id="CAI85116.1"
FT                   /translation="MQITISRQQFLKPLVQVSGAIERKHTLPILSNVLLAVENGQLSMT
FT                   GTDLEIELVASVFVGDDIADTKLTLPAKKLLDICKSLPDGSDLTLSLQEHQLLLTSGKS
FT                   RFSLTTLAAEDFPNLEQWDGEVEFQLTRLELRKLLESTHFSMANQDVRYYLNGMSFEVD
FT                   NTDIKTVATDGHRLAIAQKQLKQSLNTQRQLIIPRKGVQEIMRLMVADEELVTIQFGAN
FT                   HIRIIDIEFTFTSKLVDGRFPDYRRVLPRGGDKVITANREWLRSAFQRVSILSNEKFRG
FT                   VRLNLSNGLLKITANNPEQEQAEEVVEVGYEGADLEIGFNVSYVLDVLNTLKTEDVLFT
FT                   LADSNSSALIEGAGDEEAMYVVMPMRL"
     atgcaaataa caatatcaag acaacagttt ttaaagccat tagtgcaagt atcgggcgct        60
     attgagcgta agcatacatt gccaatttta tctaacgtat tgttagcagt agaaaacggg       120
     caactttcaa tgacaggtac cgaccttgaa attgaactcg ttgcaagcgt gtttgtaggt       180
     gatgatattg ccgatactaa gttaacatta ccggctaaaa aattactcga tatttgtaaa       240
     agcctaccag atggttcaga cctaacgtta agcttacaag agcatcagtt attactaacc       300
     agcggtaaaa gtcgtttttc gttaacgacc ttagccgccg aagactttcc taatttagaa       360
     cagtgggatg gcgaagttga gtttcaacta acgcgtttag agctgcgaaa attactagaa       420
     agcacgcatt tttcgatggc gaatcaagac gtacgttact atttaaatgg tatgtcgttt       480
     gaagtagaca atactgacat taaaacagtg gccactgatg gacatcgctt agctattgca       540
     caaaagcaat taaagcaatc gcttaatacg cagcgtcagc taattatacc tcgtaaaggg       600
     gtgcaagaaa ttatgcgcct tatggtagcc gacgaagaac tagtcactat tcagtttggt       660
     gctaatcata ttcgtattat cgatatagag tttaccttta ctagtaagtt agttgatgga       720
     cgctttcctg attaccgtcg tgtgttacct cgtggtggcg ataaagtcat tactgctaat       780
     cgcgaatggt tacgtagtgc gtttcagcga gtctctattt tatctaacga aaagtttaga       840
     ggtgtgcgtt taaacttatc caatggtttg ttaaaaatca ctgctaataa ccctgagcaa       900
     gaacaagctg aggaagtagt agaggttggt tacgaaggcg ccgacctaga aataggcttt       960
     aacgtttctt atgtacttga tgtattaaac acattaaaaa cagaagatgt actgtttaca      1020
     ttggccgatt caaacagcag cgcactaatt gaaggtgcag gcgatgaaga agcaatgtac      1080
     gtagttatgc ctatgcgttt ataa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page