(data stored in ACNUC7421 zone)

EMBL: CR954246.DSBA

CR954246.DSBA        Location/Qualifiers
FT   CDS_pept        260255..260878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="PSHAa0248"
FT                   /product="periplasmic protein, disulfide bond formation,"
FT                   /function="3.3.7 : Protein folding"
FT                   /EC_number="5.3.4.1"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85351"
FT                   /db_xref="GOA:Q3ILM4"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM4"
FT                   /protein_id="CAI85351.1"
FT                   /translation="MLKKLKLSLLLLCLPFAALAANFEVGNQYTVIDIEKSTTPQVTEY
FT                   FSFYCPHCFKFEPVAHAIEENLPAGAVFIKNHVNFLGGVSPQTQSNLSLAYLVAKKHGQ
FT                   ADTITDKIFKSIHVQRAPLTEIKDLKKLLDINGISSDTFDQDIASMPIIAAEQAMQDKQ
FT                   NKYSKLGALTGVPTFIVNDKYKINLNTIKSQEELDELVSFLLAL"
     atgcttaaaa aattaaaact gagcctacta cttctttgtc taccttttgc agcacttgca        60
     gcaaactttg aagtaggtaa tcaatataca gttatcgata tcgaaaaaag tactacacca       120
     caagttaccg aatacttttc gttttattgc ccgcattgtt ttaaatttga accggttgca       180
     cacgcaattg aagaaaatct acctgcaggt gcggtgttta taaaaaatca cgttaacttt       240
     ttaggcggcg tgtcgccaca aacacaaagt aacttgagcc tagcgtattt agttgctaaa       300
     aagcacgggc aagctgatac gattacagac aagattttta aaagtattca tgttcagcgc       360
     gcaccactga ctgaaattaa agatttaaaa aaattattag atataaatgg cattagtagc       420
     gatacgtttg atcaagatat tgccagtatg ccaattattg cagctgaaca agcaatgcaa       480
     gataaacaaa ataaatactc aaaattaggt gcgttaacag gcgttcctac ttttattgta       540
     aacgacaaat ataaaatcaa tctaaatacc atcaagagcc aagaagagct tgatgagtta       600
     gtttcatttt tactcgcact ataa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page