(data stored in ACNUC7421 zone)

EMBL: CR954246.DSBC

CR954246.DSBC        Location/Qualifiers
FT   CDS_pept        528904..529605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbC"
FT                   /locus_tag="PSHAa0515"
FT                   /product="disulfide bond isomerase, periplasmic; chaperone;
FT                   activated by DsbD; homodimeric"
FT                   /function="3.3 : Protein synthesis, maturation and folding"
FT                   /EC_number="5.3.4.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15220477, 15299592; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85605"
FT                   /db_xref="GOA:Q3ILE0"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE0"
FT                   /protein_id="CAI85605.1"
FT                   /translation="MLCTSLSAVANDVAVAPNANDPIVIKFAALGVTVKQINPSPVAGL
FT                   KELITNQGVLYASPDGQFLMQGTLIDLNNRSNLTEKALNGVRQAGLKEYEDSMIVYKAP
FT                   NEKHSITVFTDISCGYCRKLHRELDDLLEAGITVKYLAFPRGGLQGSGYNDLMNVWCAK
FT                   DQQEALTEAKSGSNTTAVKGCSAPVAEHYQLGQSFGVTGTPAIILEDGTMIPGYQPAAA
FT                   LSAALNASKAP"
     atgttatgca ctagtttaag tgccgtagcg aatgatgtgg ctgtagcccc taacgctaat        60
     gatcctattg ttattaaatt tgccgcgctt ggtgttaccg ttaagcaaat aaacccaagc       120
     ccagtagcag gtttaaaaga actgatcact aatcaaggtg tgctttatgc aagcccagac       180
     ggacagtttt taatgcaagg gacacttata gacttaaata atcgtagtaa tttaaccgaa       240
     aaagcactaa atggcgtgcg ccaagctggg ttaaaagaat acgaagattc gatgatagtg       300
     tacaaagcac ctaacgaaaa acatagcatt accgtattta ccgacattag ctgtggttat       360
     tgtcgtaaat tacaccgtga gctagatgat ttacttgaag cgggtattac cgttaagtat       420
     ttagcgtttc cgcgcggtgg gctacaaggt tcaggttata atgacttaat gaacgtatgg       480
     tgtgctaaag atcaacaaga agcactaacc gaagctaaaa gtggctcaaa tactacagca       540
     gttaaaggtt gtagtgcgcc agttgctgag cattatcagc taggtcaaag ctttggtgtt       600
     accggtacac ctgctattat tttagaagat ggcaccatga tcccaggcta tcagccagct       660
     gccgcattaa gcgctgcgct taacgctagt aaagccccat ag                          702
//

If you have problems or comments...

PBIL Back to PBIL home page