(data stored in ACNUC7421 zone)

EMBL: CR954246.DTD

CR954246.DTD         Location/Qualifiers
FT   CDS_pept        181555..181992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="PSHAa0172"
FT                   /product="D-Tyr-tRNA(Tyr) deacylase; removes other
FT                   D-aminoacids from mischarged tRNA"
FT                   /function="3.2.1.3.3 : Other"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14527667; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85275"
FT                   /db_xref="GOA:Q3IJ42"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ42"
FT                   /protein_id="CAI85275.1"
FT                   /translation="MQGLIQRVKHAKVEINNQVVGEIGQGILVLLGVEKQDDEQAADKL
FT                   LHKISNYRIFTDENDKMNLSLKDIAGELLVVSQFTLAANTKKGMRPSFSSAATPSQANE
FT                   LYEYFVAQAKALNLTVAAGEFGADMQVSLCNDGPVTFNLAV"
     atgcaaggtt taatacaacg tgtaaaacat gccaaagtag aaattaataa ccaagtagtt        60
     ggcgaaattg gccaaggaat tttagtgttg ttgggtgttg aaaaacaaga tgacgagcaa       120
     gcggccgata agttgctgca taagattagt aattaccgca tttttactga cgaaaacgac       180
     aaaatgaact taagtctaaa agatattgct ggtgagctgt tggtagtatc gcagtttact       240
     ttggcggcaa atactaaaaa gggcatgcga cctagctttt catcggcggc aactccaagc       300
     caagctaatg agttatacga atactttgta gcgcaagcca aggcgctcaa tttaacggtt       360
     gctgccggtg agtttggtgc cgatatgcaa gtgagtttgt gtaacgatgg gccagtaacc       420
     tttaatttag ctgtttag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page