(data stored in ACNUC7421 zone)

EMBL: CR954246.DUSA

CR954246.DUSA        Location/Qualifiers
FT   CDS_pept        515246..516178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusA"
FT                   /locus_tag="PSHAa0499"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11983710; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85589"
FT                   /db_xref="GOA:Q3IG92"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG92"
FT                   /protein_id="CAI85589.1"
FT                   /translation="MLDWTDRHCRTFHRKMTKHTVLYTEMITTGAILFGRGDYLHFNQH
FT                   EGPVALQLGGSDPQALAQCAKLAGERGYDEINLNVGCPSDRVQNGRFGACLMGEPQLVA
FT                   DCVAAMKAEVNIPVTVKTRIGIDEQDSYEFLCALIEASHNVGCDDFIIHARKAWLKGLS
FT                   PKENREVPPLDYPRVYQLKKDYPQLDLSLNGGVKTIEQSLEHLQHIDGVMIGREAYSNP
FT                   FILNEVDEKIYGDIANTQSRHDVVRSMYSYIEDEMRLGANFWHVARHMLGIFQGQPGAR
FT                   GFRRHLSENGHGKQADLSVMDKALSFVPE"
     atgttggatt ggactgatcg tcattgtcgt acttttcatc gtaaaatgac taagcataca        60
     gtgttgtaca cggaaatgat caccacgggt gctattttgt ttggccgagg cgactaccta       120
     cactttaatc aacacgaagg gcctgttgca ttgcagctgg gtggctctga tccacaggct       180
     cttgcacaat gtgcaaagct tgcgggtgag cgtggttatg acgaaattaa cttaaacgta       240
     ggttgcccgt cagatcgcgt gcagaatggt cgtttcggtg cttgtttaat gggtgagccg       300
     caattggttg ctgactgtgt ggcggcaatg aaagcagaag taaatatacc tgttacggtt       360
     aaaacgcgca ttggtattga tgagcaagac tcgtatgagt ttttgtgtgc acttatagaa       420
     gcgtcgcata atgttggttg tgatgatttt attattcatg ctcgtaaagc ttggttaaag       480
     gggttaagcc ctaaagaaaa ccgagaggta ccgccgcttg attatccacg tgtttatcag       540
     ttgaaaaaag attatccaca actcgattta agtcttaatg gtggtgttaa aacaattgaa       600
     caaagtttag agcatttaca gcatattgat ggtgtgatga ttggtagaga agcgtatagc       660
     aacccattta tactcaatga agtggatgaa aagatttatg gtgatatcgc taacacgcaa       720
     tctcgtcatg atgtcgtgcg ctctatgtat agttatattg aagacgaaat gcgcttaggg       780
     gctaactttt ggcatgttgc tcgtcatatg ctggggattt ttcaggggca gcctggtgcc       840
     cgtggattta ggcgtcatct gtctgaaaat ggccatggaa aacaagccga cttatcggta       900
     atggataaag ctttgagttt tgtacctgaa taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page