(data stored in ACNUC7421 zone)

EMBL: CR954246.DUSB

CR954246.DUSB        Location/Qualifiers
FT   CDS_pept        complement(359619..360599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusB"
FT                   /locus_tag="PSHAa0347"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85445"
FT                   /db_xref="GOA:Q3IIC1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC1"
FT                   /protein_id="CAI85445.1"
FT                   /translation="MNIVRIGKYQLENNVIVAPMAGVTDRPFRQLCRRLGAGLAVSEML
FT                   SSNPDVWKTEKSMNRMDHSGESGIRAVQIAGADPELMAQAAQFNVANGAQIIDINMGCP
FT                   AKKVNKKLAGSALLQFPELVEEIIDAVVNAVDIPVTLKIRTGWDLDNRNGVEIARIAER
FT                   YGIASLAVHGRTRACMYKGEAEYATIRDIKRSVSIPVVANGDITSPEKAKQVLDYTGAD
FT                   AIMIGRAAQGRPWIFREIDHYLRTGEHLQPPAIAEVRSILMEHLTNLHTFYGEPMGARI
FT                   ARKHVSWYLQTHDRDGQFRRVFNTIDNPLTQVDVLEQYFKTLAAN"
     ttgaatatag tgcgtatcgg taaataccaa cttgagaata acgtaattgt cgcgcctatg        60
     gccggtgtta cagatagacc atttagacaa ctttgtcgcc gcttaggtgc ggggcttgct       120
     gtgtctgaaa tgttatcatc gaatcctgat gtttggaaaa ccgaaaaatc gatgaaccgt       180
     atggatcaca gcggtgagtc gggaatacgc gcggtgcaaa ttgcaggagc tgatcctgaa       240
     cttatggcac aggccgcaca attcaatgtt gctaatggtg cacaaatcat agatatcaat       300
     atggggtgcc cagcaaaaaa agtgaacaag aaactcgctg gctctgcttt attacagttt       360
     cctgaacttg tggaagagat tattgatgca gtcgttaatg ctgttgatat acctgtaaca       420
     cttaaaatcc gtactggatg ggatctggat aaccgtaatg gtgtagagat tgcgagaata       480
     gctgaacgtt atggcatagc gtcacttgcc gtacatgggc gcacacgcgc atgtatgtac       540
     aagggtgaag ctgagtacgc cacgattagg gacattaaac gttcggtgtc gattcctgtg       600
     gttgcaaacg gtgatattac atcaccagaa aaagcaaagc aggtattaga ttatacgggt       660
     gcagatgcca ttatgattgg ccgagccgcc caaggtcgcc cttggatatt tagggagata       720
     gaccactatt tgcgaaccgg agagcattta cagccacctg ctattgcaga ggtgcgcagt       780
     attttaatgg agcatttaac taatctccat acgttttacg gtgagccaat gggagcgcga       840
     attgctcgta agcatgtatc ttggtatttg caaacccatg accgtgatgg tcagtttagg       900
     cgagtattta atacgatcga caacccactt acacaagttg acgtattaga gcaatacttt       960
     aaaacactag cagctaacta a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page