(data stored in ACNUC7421 zone)

EMBL: CR954246.EFP

CR954246.EFP         Location/Qualifiers
FT   CDS_pept        492054..492620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="PSHAa0474"
FT                   /product="elongation factor P (EF-P)"
FT                   /function="3.3 : Protein synthesis, maturation and folding"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85571"
FT                   /db_xref="GOA:Q3IFP5"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFP5"
FT                   /protein_id="CAI85571.1"
FT                   /translation="MANYSTNEFKGGLKIMMDGEPSSIIENEMVKPGKGQAFNRVRIRK
FT                   LISGKVLEKTFKSGESVEGADVMDTDLAYLYTDGEFWHFMNNETFEQIAADEKALGDAG
FT                   KWLVENDVCTITLWNGNPIVVTPPNFVELEITETDPGLKGDTAGTGGKPATLSTGAVVR
FT                   VPLFVQIGEVIKVDTRNGEYVSRVK"
     atggcgaatt atagcaccaa cgagttcaag ggcggcctaa aaattatgat ggatggcgag        60
     cctagtagta tcatagaaaa tgaaatggta aaacctggta aaggccaagc gtttaaccgt       120
     gttcgtatcc gtaaacttat ttcaggtaaa gtacttgaaa aaacctttaa atcgggtgaa       180
     tctgttgaag gtgctgatgt aatggatact gatttagcgt atttatacac agacggcgaa       240
     ttttggcatt tcatgaataa cgaaacattt gagcaaattg ctgctgacga aaaagcgtta       300
     ggcgatgcgg gtaaatggtt agttgaaaat gacgtgtgta caattacatt atggaacggt       360
     aatcctattg tagtaacacc acctaacttt gttgagcttg agatcactga aactgatccg       420
     ggccttaaag gtgatacagc cggaactggc ggtaaacctg caacattaag tactggtgct       480
     gtagtacgtg ttccactatt tgtacaaata ggcgaagtta ttaaagtaga cacccgtaac       540
     ggtgaatacg taagccgcgt taaataa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page