(data stored in ACNUC7421 zone)

EMBL: CR954246.EXED

CR954246.EXED        Location/Qualifiers
FT   CDS_pept        245801..247867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exeD"
FT                   /locus_tag="PSHAa0232"
FT                   /product="General secretion pathway protein D"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7789814; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85335"
FT                   /db_xref="GOA:Q3ILP0"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILP0"
FT                   /protein_id="CAI85335.1"
FT                   /translation="MVQALHLTKIKKGLAKYAALFLAASISFSVAAVEYAANFKGTDIN
FT                   EFINIVGKNLNKTIIIDPNVRGKVNVRSYELMGEALYYQFFLNVLEVYGYSAIEMDNNI
FT                   IKIEKSSDAKKSNVPLITDGSEASGDMMITRVVRVKNVSVQELGPLVRQFSDQKDGGHV
FT                   ANFNAANVMMLTGHAASVNRLVEIIRSVDQAGDKRVDIVKLKFATADDVVSVVDNIYKD
FT                   SGKGSIPEFLIPKVVADGRTNSVIVSGEGQARTRAIELIKRLDGELESQGNTKVFYLNY
FT                   AKAEDLVKVLQGVSKSLTDDTQGGSATKTRTRSNNETSIEAHPDSNSLIITAQPDTMRS
FT                   LESVIERLDIRRAQVLVEAIIIEVMEGDGINFGLQWISEQGGMLQFNNGTTVPVGALAV
FT                   AAEQARDTTVSKNIIGTESGTITQVDETTKGDYGPLASLLGGINGLAMGVIKNDWGAIV
FT                   QAVSTDSNSNILATPSITTMDNEEASILVGQEVPIITGSQTGSNNTNPFQTVERQEVGI
FT                   KLKVTPQINDGSAVQLTIEQEVSSVSGATAVDISVNKRSIKTTVMADDGGMVVLGGLID
FT                   EDVQESVSKVPLLGDIPILGHLFKSTNTTRRKRNLIVFIRPTIIRDGISMNKLSFNKYN
FT                   FIRGEQFKQREDGIELMPRTDTPILPEWNDELILPPTYEEHLRKQNAQERKDD"
     atggttcagg cgctacacct cacaaaaatt aaaaaagggt tagctaagta cgcagcactt        60
     tttctagcag caagcatttc gttttctgtt gctgcagttg aatacgctgc taactttaaa       120
     ggcactgata ttaatgagtt tattaatatt gttggtaaaa atcttaataa aacaataatt       180
     attgacccta acgtacgtgg caaagtaaat gtgcgtagtt atgagttaat gggcgaagcg       240
     ctttattatc aattcttttt aaatgtatta gaagtttatg gctattcagc cattgaaatg       300
     gacaataata taataaaaat tgaaaaaagc tcggatgcta aaaaatcaaa cgtaccgcta       360
     attacagatg gcagtgaagc cagcggcgat atgatgatta cccgagttgt acgggttaaa       420
     aatgtaagcg tgcaagagct aggtcctttg gttcgtcaat ttagcgacca aaaagatggc       480
     ggccatgttg ctaactttaa tgccgcaaac gtaatgatgc ttaccgggca tgctgcatcg       540
     gtaaaccgct tagttgaaat aatacgctcg gttgatcaag cgggcgataa gcgtgttgat       600
     attgtaaagc ttaaatttgc taccgcagat gatgtggtat ctgtagttga taatatttat       660
     aaagacagcg gaaaaggcag tattccagag tttttaatac ctaaagtggt tgccgatggc       720
     cgtactaaca gcgttattgt tagtggcgaa ggccaagcac gcacccgtgc tattgagctt       780
     attaagcgct tagacggtga gcttgaaagc caagggaaca ctaaagtatt ttatctaaat       840
     tacgcaaaag cagaagattt agttaaagta ttgcaaggtg ttagtaagtc gctaacagat       900
     gacactcaag gcggcagcgc aaccaaaaca cgtactcgca gtaacaacga aaccagcata       960
     gaagcccacc ccgattcaaa ctcattaatt attacagcac aacccgatac catgcgctcg      1020
     cttgagtcag ttattgagcg tttagatatt cgccgtgcgc aagtattggt tgaagcaatt      1080
     ataattgagg taatggaagg cgacggtatt aactttggtt tgcagtggat ttctgagcaa      1140
     ggcggtatgc tgcagtttaa taatggcaca actgtaccgg ttggtgcgtt agctgtagcg      1200
     gctgagcaag cacgtgatac taccgtatct aaaaatataa ttggtaccga aagcggcaca      1260
     attactcagg ttgatgaaac tactaagggt gattacggcc cattagcatc attactcggt      1320
     gggattaacg gcttagccat gggggtgata aaaaatgact ggggcgcaat tgttcaagcc      1380
     gtttcgaccg atagtaactc aaacattttg gcgaccccct ctattactac tatggataat      1440
     gaagaagcgt ctattttagt gggtcaagaa gtgcctataa ttactggctc gcaaaccggg      1500
     agtaataaca ccaacccatt tcaaacagtt gaacgccaag aagtgggtat aaagcttaaa      1560
     gtaaccccgc aaattaacga tggctctgct gtgcagttaa ctattgagca agaagtgtcg      1620
     agtgtaagtg gtgctactgc tgttgatatt tcagttaata agcgttcaat taaaaccaca      1680
     gtaatggccg atgatggcgg tatggtggta cttggcggat taatagatga agacgtacaa      1740
     gagagtgtat ctaaggtgcc actactaggc gacattccta ttttaggtca cttatttaaa      1800
     tcaactaata ccacacgacg taagcgtaac ctgattgtat ttattcgccc aactattatt      1860
     cgcgacggaa ttagcatgaa taagttgagc tttaataaat ataactttat tcgtggcgag      1920
     caatttaagc agcgcgaaga tggtatagag ttaatgccaa gaaccgacac ccctatttta      1980
     cccgagtgga atgatgagct aatactgcca cctacgtatg aagagcattt acgtaaacaa      2040
     aatgcacaag agcgtaaaga tgactaa                                          2067
//

If you have problems or comments...

PBIL Back to PBIL home page