(data stored in ACNUC7421 zone)

EMBL: CR954246.EXEE

CR954246.EXEE        Location/Qualifiers
FT   CDS_pept        247860..249425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exeE"
FT                   /locus_tag="PSHAa0233"
FT                   /product="General secretion pathway protein E (Type II
FT                   traffic warden ATPase)"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1640836; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85336"
FT                   /db_xref="GOA:Q3ILN9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN9"
FT                   /protein_id="CAI85336.1"
FT                   /translation="MTKAIAEINQDVVHPNAHHPDELLTSDDLVELPAKRLPFSYARRA
FT                   GVLLSKNKEQRIVYYRGELDIDVLLEVRRIAGHGFTLEQLADDKFELLLEASYQRDSSE
FT                   TQQMMEDIGNEVDLFSLVDELPQTEDLLAGDDDAPIIKLINAMLSEAIKEGASDIHIET
FT                   FEQELVIRFRVDGVLKEVLKPNRKLASLLVSRIKVMAKLDIAEKRIPQDGRISLRIAGR
FT                   AVDVRVSTMPSSFGERVVLRLLDKNNAHLNLEDLGMTAQNRELFANLISKPHGIILVTG
FT                   PTGSGKSTTLYAGMSQINSRDRNILTVEDPIEYEIPGIGQTQVNTKVGMTFARGLRAIL
FT                   RQDPDVVMVGEIRDLETAQIGVQASLTGHLVMSTLHTNTASGAITRMEDMGVEPFLLSS
FT                   SLLGVLSQRLVRTLCKNCKKEHVADERECQLLGVPFESKPTIHRAVGCEACNFNGYKGR
FT                   TGIHELLVVDETIREMIHNGKGEQSVEKYIRKLSPSIRQDGCSRVLAGKTTLEEVLRVT
FT                   REEG"
     atgactaagg cgattgcaga gataaaccaa gatgtggttc atcctaatgc gcatcatccg        60
     gacgagctat taaccagtga cgacttagtt gagttacccg ctaaacgttt gcctttttca       120
     tacgcacggc gagccggtgt actgctgagt aaaaataaag agcagcgcat agtgtattac       180
     cgtggcgaac ttgatattga cgtactgtta gaagtacgcc gtattgcagg gcatggtttt       240
     acgcttgagc agcttgctga tgacaagttt gagctactgc tagaggcttc gtatcagcga       300
     gatagttctg aaacgcaaca aatgatggaa gacattggca acgaagttga cttgttttca       360
     ttagtagacg aactgccaca aaccgaagat ttactggcag gcgatgatga tgcgccaatt       420
     attaagctta taaatgcgat gctcagtgaa gcaattaaag agggtgcgtc tgatattcat       480
     attgaaacct ttgagcaaga actggttatt cgctttaggg ttgatggtgt attaaaagag       540
     gtacttaaac ctaatcgtaa attagcatcc ttgctggtat cgcgaattaa ggtaatggct       600
     aagctcgata ttgccgaaaa acgtatacca caagatggcc gtattagttt gcgtattgca       660
     gggcgtgcag ttgatgtacg ggtatcaacc atgccatcga gttttggtga gcgtgttgtg       720
     ctgcgtttac tggataaaaa taacgcgcac ttaaatcttg aagatttagg tatgaccgca       780
     caaaaccgtg aattgtttgc aaatttaatt agtaaacctc atggcattat tttagtaacc       840
     gggcctacag gctctggtaa aagtaccacc ttgtacgcag gtatgagtca aataaactct       900
     cgcgatcgta atattttaac ggttgaagat cccattgaat acgaaatacc gggcattggc       960
     caaacgcaag taaatactaa agtaggtatg acctttgcgc gtggcttacg ggctatttta      1020
     cgtcaagacc ccgatgtagt gatggtaggt gaaatacgtg acctagaaac cgctcaaatt      1080
     ggtgtgcaag catcattaac cggtcacttg gtaatgtcta cgttgcatac aaatactgct      1140
     tctggcgcta ttactcgtat ggaagatatg ggagtggagc catttttact ttcatcgtcg      1200
     ttactcggtg tgttatcgca gcgactagta cgtacactgt gtaaaaattg taaaaaagaa      1260
     catgtagccg atgagcgcga gtgccagtta ttaggcgtac cgtttgaaag taaaccaact      1320
     atacaccgtg cagtagggtg tgaagcatgt aactttaatg gttataaagg ccgtactggt      1380
     attcatgagt tattagtggt ggacgaaacc attcgtgaaa tgatccacaa tggtaagggc      1440
     gagcaaagcg ttgaaaaata cattcgcaag ctcagtccaa gtattcgtca agatggctgt      1500
     agccgtgtac ttgcaggtaa aacaacactt gaagaagtat tgcgtgttac ccgtgaggaa      1560
     ggctaa                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page