(data stored in ACNUC7421 zone)

EMBL: CR954246.FADA

CR954246.FADA        Location/Qualifiers
FT   CDS_pept        complement(11474..12643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="PSHAa0010"
FT                   /product="3-ketoacyl-CoA thiolase; (thiolase I, acetyl-CoA
FT                   transferase), in complex with FadB catalyzes EC 2.3.1.16"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="2.3.1.16"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8446033; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85124"
FT                   /db_xref="GOA:Q3IJ24"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ24"
FT                   /protein_id="CAI85124.1"
FT                   /translation="MNNPVIVDCIRTPMGRSKGGVFKNKRAEDLSAHLMKGLLDRNPAV
FT                   DPASIDDIYWGCVQQTLEQGFNVARNAALLAGIPHSVPAVTVNRLCGSSMQALHDAARA
FT                   IMTGAGDTYLIGGVEHMGHVPMTHGNDFHPGLATSIAQAAGSMGLTAEYLATLHGISRE
FT                   QQDEFAYRSHQRAQAATVEGRFRREILAMEGHAADGSLILVEDDEVIRPETTVEGLSKL
FT                   RPVFNPASGTVTAGTSSALSDGASAMLVMSEAKAKELGLPIRARIKAMAVAGCDPSIMG
FT                   YGPVPASKKALAQAGITIDDLGVVELNEAFAAQSLPVMKDLGLMDVVDEKVNLNGGAIA
FT                   LGHPLGCSGSRISTSLIHLMEDKNVRYGLATMCIGLGQGIATVFERVQD"
     atgaataatc cagtaattgt agattgtatc cgcacaccta tgggtcgttc taaaggtggc        60
     gtattcaaaa ataaacgtgc cgaagactta agcgcacatt taatgaaagg cttactcgat       120
     cgcaacccag cagttgatcc agcatcaatt gacgatattt attggggttg tgtacagcaa       180
     acattagagc aaggctttaa cgttgcacgt aacgctgcat tacttgccgg tattccacat       240
     agcgtaccag cagtaacagt taaccgttta tgtggctcgt caatgcaagc attgcatgac       300
     gcagcacgcg caataatgac tggcgctggc gacacttact taattggtgg tgttgagcac       360
     atgggccacg tacctatgac tcacggtaac gactttcacc caggtttagc aacaagcatt       420
     gcgcaagctg ctggctctat gggcttaaca gctgaatacc tagcaacact gcatggtatt       480
     agccgtgagc agcaagatga atttgcgtac cgctcacatc aacgtgctca agctgcaact       540
     gttgagggac gttttcgccg cgaaatttta gcaatggaag gtcacgcagc agatggttct       600
     cttatcttag ttgaagacga cgaagtaatt cgtccagaaa caacggtaga aggcctgtca       660
     aagctgcgcc cagtgtttaa tcctgcatcg ggtacggtaa cagccggaac ttcttctgca       720
     ctttctgacg gcgcatctgc aatgttagta atgagcgaag caaaagcaaa agaacttggc       780
     ttaccaattc gcgcacgcat taaagcaatg gcagtagcgg gttgcgatcc atcaatcatg       840
     ggttacggcc cagtaccagc aagcaaaaaa gcacttgcac aagccggtat tacaattgat       900
     gacttaggcg tagttgagct taacgaagcc tttgcagcac aatcattacc tgtaatgaaa       960
     gatttagggt taatggatgt agttgacgaa aaagtgaatt taaacggcgg cgcaatcgca      1020
     cttggacacc cactaggctg ttcgggttcg cgtattagca catcgcttat tcacttaatg      1080
     gaagacaaaa atgtacgata cggtttagca actatgtgta ttggtttagg ccaaggcatt      1140
     gccactgtat ttgaacgtgt tcaagactaa                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page