(data stored in ACNUC7421 zone)

EMBL: CR954246.FADB

CR954246.FADB        Location/Qualifiers
FT   CDS_pept        complement(12648..14807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="PSHAa0011"
FT                   /product="multifunctional 3-hydroxybutyryl-CoA epimerase,
FT                   delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase, enoyl-CoA
FT                   hydratase (N-terminal); 3-hydroxyacyl-CoA dehydrogenase
FT                   (C-terminal)"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="5.3.3.8"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="5.1.2.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8446033; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85125"
FT                   /db_xref="GOA:Q3IJ23"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ23"
FT                   /protein_id="CAI85125.1"
FT                   /translation="MLYKSDSFEVSFIKENIAEFKFCATASVNTLSQQTLSDCATALKQ
FT                   LAANTDIKGMIFTSDKEHFIIGADVFEFLPIFTRSEAELVTWIKEATDVFDAIEDLPFP
FT                   TLSAVNGLALGGGCEWVLATDYRVASETAQMGLPEVTLGIMPGFGGTVRLPRIIGADNA
FT                   MMWITSGSTNRAADALKVGAFDAVVSADKLIESSVSTLELAIAGKLDWQAKRNVKLQPL
FT                   KLNRVEQGMSFAMAEGMVMAKTKGHYPAPVMAVKTIKAAANCTRDEAMAIENANFAKLA
FT                   GTPEVAAQIGIFLADQYIKGKSRKLAKQSDVEIKQAAVLGAGIMGGGIAYQSAYKGTPI
FT                   IMKDIQQDALDLGMGEASKLLGQKVKRGHMSMEKMLGTLSKIKPTLNDSDLQSADIIVE
FT                   AVVENPKVKQAVLAELEKTMPEGTVLTSNTSTICIDLLAEALDKPENFCGMHFFNPVPK
FT                   MPLVEIIRGAKTSDKTINAVVDYALKLGKSPIVVNDCPGFFVNRVLFPYFAGFSKLVVE
FT                   GANFAKVDKVMENVFGWPMGPAYLLDVVGIDTAFHCTGVMADGFPERMARADKDPVTIF
FT                   ANEKRFGQKNKAGFYKYETDRRGRLKKSHDETAIELLKPITEAEKAFDKQEIIDRCMIP
FT                   MLNEVLLCLQEGIVASPQEADMALVYGVGFPPFRGGAFRYLDQTGLANFVATADKYAHL
FT                   GAIYQVSEQTRQWAEEGRVFYKVEG"
     atgttatata aaagcgattc ctttgaagtt agcttcataa aggaaaacat cgccgagttt        60
     aagttttgtg ctacagcttc tgtaaacaca ctatctcagc aaaccctttc agattgcgca       120
     acagcattaa aacaattagc tgcaaatact gatataaaag gcatgatttt taccagtgat       180
     aaagaacact ttattattgg tgccgacgta ttcgaatttt tacctatatt tactagatct       240
     gaagcagaac tagtaacttg gataaaagaa gccactgacg tttttgacgc tatcgaagac       300
     ttaccattcc caactctaag cgctgtaaat ggcttagcac ttggcggtgg ctgtgagtgg       360
     gtacttgcta ccgattatcg tgtagcaagc gaaactgcac aaatgggtct tccagaagta       420
     acccttggca taatgcctgg ttttggtggc acagttcgct taccgcgtat tattggtgcc       480
     gataacgcca tgatgtggat tacctcaggt tctactaacc gcgcagcaga tgcccttaaa       540
     gtaggtgctt ttgacgcagt agttagtgct gacaaactta tagagtcaag tgtatcaaca       600
     cttgaattag caattgctgg caagctcgat tggcaagcaa aacgcaatgt aaagctacaa       660
     ccacttaaat taaaccgtgt tgagcaaggc atgagctttg caatggctga aggcatggta       720
     atggctaaaa ctaaaggcca ctatcctgca cctgtaatgg ctgtaaaaac cattaaagca       780
     gctgctaact gtactcgtga tgaagcaatg gcaatcgaaa atgccaactt tgctaaatta       840
     gcaggcacgc cagaagttgc cgcgcaaatt ggtatatttc tagccgacca gtacattaaa       900
     ggtaaatcac gtaaacttgc taaacaaagc gatgtagaaa ttaaacaagc tgcagtgtta       960
     ggtgctggca ttatgggcgg cggtattgca taccagtctg cttataaagg tacacctatt      1020
     ataatgaaag atatccaaca ggatgcactt gacttaggta tgggcgaagc ctctaagtta      1080
     cttggccaaa aagttaaacg tggccatatg tcgatggaaa aaatgcttgg tacgctaagc      1140
     aaaattaaac cgacccttaa tgattctgat ctacaaagtg ccgatattat tgttgaagcc      1200
     gtagtagaga accctaaagt taagcaagca gtacttgcag agcttgagaa aaccatgcca      1260
     gagggcacgg tacttacctc aaacacttca actatttgta ttgatttact tgcagaagcg      1320
     ttagataaac cagaaaactt ctgtggtatg cactttttta acccagtacc gaaaatgccg      1380
     ttagtagaaa ttatccgtgg tgcaaaaacc tctgataaaa ccattaacgc cgtagttgat      1440
     tacgcgctta aattaggcaa gtctcctatt gttgttaacg attgccctgg cttttttgta      1500
     aaccgtgttt tattccctta ctttgcaggt tttagcaaat tagtagttga aggtgctaac      1560
     tttgcaaaag tagataaagt aatggaaaac gtatttggct ggcctatggg tccggcttac      1620
     ttacttgatg ttgtaggtat tgataccgct tttcattgta ctggcgtaat ggccgatggc      1680
     ttccctgagc gcatggcgcg tgcagataaa gacccagtga ctatttttgc taacgaaaag      1740
     cgttttggcc aaaagaacaa agctggtttt tataagtacg aaacagatcg tcgcggtcgt      1800
     cttaaaaaat cgcatgacga aactgcaatt gagctactta agccaattac tgaagcagaa      1860
     aaagcattcg ataaacaaga aatcattgac cgttgtatga tcccaatgct taacgaagtg      1920
     ctactttgtt tacaagaagg cattgttgca tcaccacaag aagctgatat ggcacttgtt      1980
     tacggtgttg gtttccctcc atttagaggc ggcgcgttcc gttacttaga tcaaaccggt      2040
     ttagctaact ttgtggcaac tgccgacaaa tatgctcact taggtgcgat ttatcaagta      2100
     tcagagcaaa ctcgtcaatg ggccgaagaa ggtcgtgttt tctataaggt ggaaggttaa      2160
//

If you have problems or comments...

PBIL Back to PBIL home page