(data stored in ACNUC7421 zone)

EMBL: CR954246.FBP

CR954246.FBP         Location/Qualifiers
FT   CDS_pept        complement(480524..481492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="PSHAa0463"
FT                   /product="Fructose-1,6-bisphosphatase"
FT                   /function="2.1.1.1 : Glycolysis/gluconeogenesis"
FT                   /EC_number="3.1.3.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2843822; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85560"
FT                   /db_xref="GOA:Q3IFQ5"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFQ5"
FT                   /protein_id="CAI85560.1"
FT                   /translation="MRRLPPVLLEDGCPRELISLIRTILAACKEISFRVGQGELSGVLG
FT                   STLDENIQGETQKKLDVLTNQLLKDILLESGYVKAIASEEEDYTVAGNPDAEYIVAFDP
FT                   LDGSSNTDINSLVGTIFSVMKAPEGADPADQSIFMQPGINQVAAGYVLYGPSTILALTT
FT                   GKGTRFFTLDKTHGTFLLTQDFAKIPADTNEYAINASNQRHWQPAMQNYINDLVAGDTG
FT                   PRARNFNMRWIAAMVGDVHRVLSRGGLFTYPTDTKNPSQPNKLRLLYEANPMAMLVEQA
FT                   GGIASTGTERIMDIQPNAIHQRVAVILGSKNEVETCLGYHK"
     atgcgtagac ttcctccagt attacttgaa gatggttgcc caagagagtt aatctctttg        60
     atcagaacta ttttagccgc atgtaaagaa atttcatttc gtgttggcca aggcgaatta       120
     tcgggtgtat taggctcaac acttgacgag aatattcaag gcgaaactca aaagaagctt       180
     gatgttttaa ccaaccaact gcttaaagat atattattgg aatcgggcta cgtaaaagcc       240
     atcgcctctg aagaagaaga ctacacagtt gctggtaatc ctgatgcaga atatattgta       300
     gcgtttgacc cacttgatgg ctcatcaaac accgacataa actcgttagt aggtactatt       360
     ttttcagtaa tgaaagcgcc tgaaggcgca gatcctgctg accaaagtat ttttatgcaa       420
     ccgggtatta atcaagtagc ggcaggttat gtattatatg gtccatcgac tatattggcg       480
     ctaacgacag gtaaaggcac ccgctttttc accctagata aaactcacgg caccttttta       540
     ttaactcaag attttgcaaa aataccagca gataccaacg aatatgctat taatgcgtca       600
     aaccaacgcc attggcaacc tgctatgcaa aactacatta acgaccttgt agctggcgac       660
     actggcccac gcgctcgaaa ctttaatatg cgctggattg ctgcaatggt aggcgatgta       720
     caccgcgtat taagccgtgg cgggttattt acctacccaa ccgataccaa aaacccaagc       780
     cagccaaata agcttcgtct gctttacgaa gcaaacccta tggccatgct agtagagcaa       840
     gctggcggga ttgcgtcaac tggcaccgag cgtattatgg atatacagcc taatgccatt       900
     caccagcgcg tagctgtaat tttaggctca aaaaacgaag tagaaacctg cttgggatat       960
     cataagtaa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page