(data stored in ACNUC7421 zone)

EMBL: CR954246.FIS

CR954246.FIS         Location/Qualifiers
FT   CDS_pept        complement(359309..359599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="PSHAa0346"
FT                   /product="DNA-binding protein for site-specific
FT                   recombination and inversion, transcription of rRNA and tRNA
FT                   operons, and DNA replication"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2835774, 2837762, 1459953; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85444"
FT                   /db_xref="GOA:Q3IIC2"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC2"
FT                   /protein_id="CAI85444.1"
FT                   /translation="MFEQNVTSPFITNPHVQAHEKPQPLRDAVKKAVHHYLKQLNGQDV
FT                   QDVYDLVLSELEAPLLEEVMTYTRGNQTRAAILLGINRGTLRKKLKKYGMN"
     atgttcgaac aaaacgtgac ttctccattt atcactaacc ctcatgttca ggcacacgag        60
     aaaccgcagc cattacgtga cgcagtaaag aaagctgttc accactattt aaagcagctt       120
     aacggtcaag atgtgcaaga cgtttacgac cttgttcttt cagagctaga agcgccatta       180
     ctggaagaag taatgacgta tacacgtggt aaccaaacac gtgcagcaat tttactaggt       240
     atcaaccgtg gtactttacg taaaaagctt aaaaaatacg gcatgaacta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page