(data stored in ACNUC7421 zone)

EMBL: CR954246.FMT

CR954246.FMT         Location/Qualifiers
FT   CDS_pept        complement(25383..26348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="PSHAa0022"
FT                   /product="10-formyltetrahydrofolate:L-methionyl-tRNA(fMet)
FT                   N-formyltransferase"
FT                   /function="3.3.6.2 : Chemical modifications"
FT                   /EC_number="2.1.2.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 769821, 769822, 98518, 8112305, 8887566; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85136"
FT                   /db_xref="GOA:Q3IDI3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDI3"
FT                   /protein_id="CAI85136.1"
FT                   /translation="MTQPLRIIFAGTPDFAARHLQALIQSEHQIVGVYSQPDRPAGRGK
FT                   KLKASEVKELALEHNLPVFQPQSLKTEDALNELTRLNADIMIVVAYGLILPKAILDAPR
FT                   LGCLNVHGSILPRWRGAAPIQRAIWAGDEQTGVTIMQMNEGLDTGDMLHISRCPISATE
FT                   TSASLYTKLADLGPGALIDTINNLANGKITPEPQNDAAANYAKKLSKDEANIDWSMSAA
FT                   QIERNIRAFNPWPVCFTQMGGQPVKIYQAHVVEQSSSQPDNNGRVLSSDKNGVIVGCGE
FT                   HALCITQLQPQGKKPMAINDFLNGRSDWVTPGTILGENNE"
     gtgactcaac cattacgcat tatatttgcc ggtacgccgg actttgccgc acgtcattta        60
     caagcgctga tacaaagcga acaccaaata gtgggtgtgt atagccagcc agaccgcccg       120
     gcaggtcgtg gtaaaaaatt aaaagccagt gaagtcaaag agctcgcact tgagcacaac       180
     ttaccggttt ttcagccaca atcactaaaa acagaagacg ccttaaatga gcttactaga       240
     cttaatgccg acatcatgat tgtagtggct tatggcttaa ttttacctaa agccatttta       300
     gatgcgccgc gattaggctg tttaaatgtg catggttcta ttttaccacg ctggcgtggt       360
     gctgccccga ttcaacgtgc tatttgggca ggtgatgaac aaaccggcgt caccataatg       420
     caaatgaatg aagggctaga tactggcgac atgttacata taagccgctg ccctattagt       480
     gccaccgaaa ccagtgccag tttatatact aaattagctg atcttggccc tggtgcactt       540
     attgacacta ttaacaactt agcgaatggt aaaataaccc ctgagccaca aaatgatgcc       600
     gcggctaatt acgctaaaaa gctctcaaaa gacgaagcca atattgactg gtctatgagc       660
     gcggcgcaaa ttgagcgtaa cattcgcgcg tttaatccgt ggccggtatg cttcacccaa       720
     atgggagggc agccagtaaa aatttatcaa gcacatgttg tagagcaatc aagcagccag       780
     cctgataata acgggcgcgt tctgtcgagc gacaaaaatg gcgttattgt aggttgtggc       840
     gaacatgctt tatgtattac gcaattacaa ccgcaaggta aaaaaccaat ggcaattaac       900
     gactttttaa atggtcgtag tgactgggtt actcctggca caatattagg cgaaaataat       960
     gagtaa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page