(data stored in ACNUC7421 zone)

EMBL: CR954246.FOLE

CR954246.FOLE        Location/Qualifiers
FT   CDS_pept        complement(75426..75980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="PSHAa0073"
FT                   /product="GTP cyclohydrolase I"
FT                   /function="2.5.2 : Folic acid"
FT                   /EC_number="3.5.4.16"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10049741, 14642352; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85182"
FT                   /db_xref="GOA:Q3IF89"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF89"
FT                   /protein_id="CAI85182.1"
FT                   /translation="MHNELKQGYENIITAVGEDPNREGLLDTPKRAAKAMEYLTQGYRQ
FT                   TLEEITNNAVFTSDADDMVLVQDIELYSMCEHHLLPFTGRCHIAYIPNGKVLGLSKFAR
FT                   IVDMFARRFQIQEQLTHQIAKAVEEVTGATGVGVIVEAKHMCMMMRGVEKQNSSMRTSV
FT                   MLGNFRADPKTRNEFLQLIKG"
     atgcataacg aactaaaaca aggctatgaa aatattatta ccgctgtagg ggaagatcct        60
     aacagagaag gcttactcga cacgccaaaa cgtgctgcta aagcaatgga atacttaact       120
     caagggtatc gtcaaacatt agaagaaatt actaataacg cagtatttac ctcagatgca       180
     gacgacatgg tattagtaca agacatagag ctttactcta tgtgtgagca tcacttgtta       240
     ccttttactg gccgttgtca tattgcttat attcctaatg gcaaagtatt gggactgtct       300
     aaatttgccc gtattgttga catgtttgcc cgtcgttttc aaattcaaga gcaactaact       360
     catcaaattg ctaaagccgt tgaagaagta acgggtgcaa ccggggttgg cgtaattgtt       420
     gaagctaaac atatgtgtat gatgatgcgc ggcgtagaaa agcaaaattc aagtatgcgt       480
     acctctgtaa tgctgggtaa ctttagagcc gatccaaaaa cacgtaatga gtttttgcag       540
     ctaataaaag gctaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page