(data stored in ACNUC7421 zone)

EMBL: CR954246.FOLM

CR954246.FOLM        Location/Qualifiers
FT   CDS_pept        complement(76007..76726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folM"
FT                   /locus_tag="PSHAa0074"
FT                   /product="putative alternative dihydrofolate reductase,
FT                   NAD(P)-binding domain"
FT                   /function="2.5.2 : Folic acid"
FT                   /EC_number="1.1.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 14617668; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85183"
FT                   /db_xref="GOA:Q3IF88"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF88"
FT                   /protein_id="CAI85183.1"
FT                   /translation="MTPPILITGAGQRIGLALAKHFIAQGQPIIITYRTRHAAVDLLEQ
FT                   QGAVCIYADFSTDDGISTFIKALKEHTNSLRAILHNASSWDCEANNANFAQLFDNMMRI
FT                   HAKTPYLINLLCAELLLNYQTEMNTPADIIHLTDYVVETGSPKHVAYAASKAALDNLTK
FT                   SFSAKYAPNIKVNSVAPSLIIFNEHDDEQYRAKTLKKSLMGIEPGCQEIINSIDLLLHS
FT                   HYITGRAIPVDGGRHLK"
     atgacaccac cgattttaat tacaggtgct gggcaacgca ttggccttgc tttagctaaa        60
     cattttattg cacaagggca gccgataatt attacctatc gtactcgcca cgctgcagtt       120
     gatttactgg agcagcaggg cgctgtatgc atttatgcag actttagtac tgatgatggt       180
     attagcactt ttattaaagc acttaaagag cataccaact cactacgcgc tattttgcat       240
     aatgcttcca gttgggactg cgaagctaat aacgccaact ttgcgcaact gtttgacaat       300
     atgatgcgaa ttcatgcaaa aacaccttat ttaattaatt tactgtgtgc agagttatta       360
     ctaaattatc aaactgagat gaatactccc gcagatatta ttcatcttac cgattacgta       420
     gtagaaacag gtagcccaaa acatgtcgct tatgcagcaa gtaaagcagc gcttgataac       480
     ttaacaaagt cgttcagtgc taagtacgca cctaatatta aagtaaattc ggttgcacca       540
     tcgttaatta tttttaatga gcatgatgat gaacaatatc gtgctaaaac gctgaaaaag       600
     tcattaatgg gtatcgaacc aggatgccaa gaaataatca atagtattga tttactatta       660
     catagccact acatcacagg ccgcgctata cctgtagatg gtggtcggca tttaaagtaa       720
//

If you have problems or comments...

PBIL Back to PBIL home page