(data stored in ACNUC7421 zone)

EMBL: CR954246.FOLX

CR954246.FOLX        Location/Qualifiers
FT   CDS_pept        complement(75066..75422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folX"
FT                   /locus_tag="PSHAa0072"
FT                   /product="D-erythro-7,8-dihydroneopterin aldolase"
FT                   /function="2.5.2 : Folic acid"
FT                   /EC_number="4.1.2.25"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9651328; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85181"
FT                   /db_xref="GOA:Q3IF90"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF90"
FT                   /protein_id="CAI85181.1"
FT                   /translation="MANAIINVTNLRLRTFIGFNQEEREKKQDVVINLEIHYPAHDACK
FT                   TDEVDQALNYKVITKEVITLVEQGDFLLLEKLVAEILAVCHSHPSVHYAKARVDKPHAL
FT                   RFADSVSLTLDWAK"
     atggctaatg caattattaa cgtaaccaat ttacgactgc gtacttttat tggctttaac        60
     caagaagagc gcgagaaaaa gcaggatgta gtgattaact tagaaattca ttaccctgca       120
     cacgacgcct gtaaaaccga tgaagtagat caagcactaa actacaaagt aattaccaaa       180
     gaagtaatca ctttagtaga acaaggtgac tttttattac tcgaaaaact ggttgctgaa       240
     attcttgctg tttgtcattc acacccaagt gttcattatg ctaaggctcg cgtagataaa       300
     ccgcatgcat tacgctttgc cgattctgtg tctttgacgt tagattgggc taaataa          357
//

If you have problems or comments...

PBIL Back to PBIL home page