(data stored in ACNUC7421 zone)

EMBL: CR954246.FRE

CR954246.FRE         Location/Qualifiers
FT   CDS_pept        complement(107724..108437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fre"
FT                   /locus_tag="PSHAa0104"
FT                   /product="NAD(P)H-flavin reductase"
FT                   /function="2.5.14 : Other"
FT                   /EC_number="1.16.1.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10960098, 12054743; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85213"
FT                   /db_xref="GOA:Q3IDJ9"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ9"
FT                   /protein_id="CAI85213.1"
FT                   /translation="MQTLKAEVVAISPLTEFVHKVILKPQQPVSFEAGQYMHLVLSEND
FT                   KRAFSIASRPSQCDQIELHIGASGTDTYAMQSLEHLRNALNEKQLIEIEAGLGISQLRL
FT                   QCERPIILLAGGTGFSYAKSMADHLAEISCDRPVLLYWGVREESALYAHREMQVWADSH
FT                   KNFQFIPVVENPSPDWQGHTGYVHKAVMQDIVSLAPYDIYMAGRFDMIGIVRDDFIAHG
FT                   AIRENMYADAFAFIK"
     atgcaaacat taaaagctga agttgttgct atcagcccac ttacagaatt tgttcataaa        60
     gtaattttaa aaccacaaca accggtttcg tttgaagcag gccaatacat gcatcttgta       120
     ttgagcgaaa atgacaagcg tgcattttcg attgccagcc gcccttcaca atgcgatcaa       180
     atagagttac atattggcgc ttcgggaacc gatacatatg caatgcagtc gcttgaacat       240
     ttacgcaatg cacttaacga aaagcagcta atagagatag aagcaggctt aggtatatcg       300
     caacttcgtt tacagtgtga gcgtccaatt attttacttg ctggcggtac tgggttttca       360
     tatgcaaaat caatggctga tcacctagct gaaattagct gcgaccgccc ggtattatta       420
     tactggggcg taagagaaga atcggcactt tatgcacacc gcgaaatgca agtgtgggcc       480
     gatagccaca aaaactttca gtttattccg gtagtagaaa acccatcgcc tgattggcaa       540
     ggacataccg gttatgtaca caaagccgta atgcaagata tagtatcgct agcgccttac       600
     gatatttaca tggctggacg ttttgacatg ataggcatag ttcgtgacga ttttattgct       660
     catggtgcta ttcgcgaaaa catgtacgca gatgcgtttg catttattaa ataa             714
//

If you have problems or comments...

PBIL Back to PBIL home page