(data stored in ACNUC7421 zone)

EMBL: CR954246.FTSE

CR954246.FTSE        Location/Qualifiers
FT   CDS_pept        369614..370291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="PSHAa0355"
FT                   /product="cell division protein (ABC transporteur
FT                   superfamily, ATP_binding)"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3025556, 10048040; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85453"
FT                   /db_xref="GOA:Q3IIB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB3"
FT                   /protein_id="CAI85453.1"
FT                   /translation="MINFQQVSKTYPGGHRALEKVNFHIKPGELAFLTGHSGAGKSTLL
FT                   KLISLMERPSAGSVFINGIDLNKVNSRQIPYVRRDIGIIFQNHRLLERYTIFDNVALPL
FT                   IIEGTHHKQIAKRVHGALDKVGLIDKIKCHPSMLSGGEQQRVGIARAIVNSPPILLADE
FT                   PTGNLDPELSMEILRLFEEFNNHGTTVLIATHDLGLVARMKYRSLTLKDGRMIQDPLAE
FT                   GAL"
     atgataaatt ttcagcaagt aagtaaaacc tatccaggcg ggcatcgcgc tcttgaaaaa        60
     gttaattttc atattaagcc tggtgaactc gcgtttttaa ccggccacag tggcgcgggt       120
     aaaagtacgc tgttaaagct aattagctta atggaacgcc cttctgctgg aagtgtgttt       180
     attaacggta tcgatttaaa caaagtaaac tcacggcaaa ttccttatgt ccgtcgcgac       240
     atcggcatta tatttcaaaa ccaccgctta ttagagcgct acactatatt tgataacgta       300
     gcactgccct tgatcattga aggcacacac cataagcaaa ttgcaaagcg tgtgcatggc       360
     gcgcttgata aggtaggttt gattgataaa attaaatgcc acccatctat gctctctggt       420
     ggcgagcagc agcgtgtggg tattgcccgc gcaattgtta actccccgcc aatattatta       480
     gcagatgaac ctacgggtaa cctagatcct gagctttcaa tggaaatatt acgtcttttt       540
     gaagagttta ataaccatgg aacaaccgta cttattgcta cccacgatct aggattagtg       600
     gcccggatga agtatcgcag cttaacccta aaagatggtc gtatgattca agatccgtta       660
     gccgagggcg cattatga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page