(data stored in ACNUC7421 zone)

EMBL: CR954246.FTSX

CR954246.FTSX        Location/Qualifiers
FT   CDS_pept        370288..371274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="PSHAa0356"
FT                   /product="cell division protein"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3025556; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85454"
FT                   /db_xref="GOA:Q3IIB2"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB2"
FT                   /protein_id="CAI85454.1"
FT                   /translation="MSLLFKSRQNSNDKQKKSVFAGGYFFIINIFRQGVHSLGEMWRTP
FT                   LASLMTIAVLGLSLTLPASLYLVVKNVQQVSSGFEEASEISLFVKESMNEQETQTLVKR
FT                   LALYPEVESVTFISKQQALQEFKQVSGFGQALSYLNSNPLPDVVLVIPTSRHRQPNAAK
FT                   VLLTKLESEREVDFGKLDIAWLERLNALLSLLKESVITIALLLLTSVTLIIGNTIRLSI
FT                   MDKKEEIQVMKLVGATNTFIHAPFLWTGIWYGVIGGLFAFICVALMMWWLSTAVSSVAS
FT                   VYQTSFSLIGLTLKEFGSLVLLATSLGFIGSYLSVNRYIKEIEPDKV"
     atgagtttac tttttaaaag tcgtcaaaat agtaacgata aacaaaaaaa atcagtattt        60
     gctggcggtt atttttttat tattaatatt tttcgccaag gcgtacatag cttaggtgaa       120
     atgtggcgta cacctctagc gtcgttaatg actattgcag tactgggttt gagcttaacc       180
     ttgccagcta gcttatactt agtggttaaa aatgtgcaac aggtaagcag tggctttgaa       240
     gaggccagcg aaatttcttt gttcgtaaaa gaaagcatga acgagcaaga aacccaaacc       300
     ttagtaaagc gcttagcact ctacccagaa gtagaaagcg tgacatttat ttccaagcag       360
     caagctctgc aagagtttaa gcaagtatct ggatttggtc aggcgttaag ctatttaaat       420
     agcaatccgt tacccgatgt tgtgctcgtt ataccaacat cgcgacacag acaacctaat       480
     gccgcaaaag tacttttaac taagcttgaa agtgagcgag aagttgattt tggcaagctt       540
     gatatagctt ggcttgagcg cctaaatgca ttgctaagcc tattaaaaga aagtgttatt       600
     accattgcgc tgctattgct tacctcggta acgctaataa taggtaacac tattcgtttg       660
     tctattatgg ataaaaaaga agaaatacaa gtaatgaagc tggtaggcgc tactaatact       720
     tttattcacg cccccttttt atggaccgga atatggtatg gcgttatagg tgggttattt       780
     gcatttatat gtgtggcgct aatgatgtgg tggctatcaa ctgccgttag tagtgtggca       840
     agcgtttacc aaactagttt ttctttaatt ggcttaacct taaaagaatt tggctcgctg       900
     gtactgcttg ctactagctt agggtttatt ggttcgtact tatcggttaa tcgttatata       960
     aaagaaattg agccagataa agtctga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page