(data stored in ACNUC7421 zone)

EMBL: CR954246.FTSY

CR954246.FTSY        Location/Qualifiers
FT   CDS_pept        367425..369380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="PSHAa0354"
FT                   /product="Cell division transporter substrate-binding
FT                   protein FtsY"
FT                   /function="1.7.2 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3025556, 2161989, 8194520, 15148364"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85452"
FT                   /db_xref="GOA:Q3IIB4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB4"
FT                   /protein_id="CAI85452.1"
FT                   /translation="MAKKSKLLSWLGFGKSDKKQQAEQSAQEADNQQQARLAAEKAEAE
FT                   HLEQQRLAAEKAEQEAAEKIAAEQAQREQAEKLAIEKANAELLAKQQADAHALQLEQQQ
FT                   RLAEQEAQMRLEQEKAAAEQAEAERLEQARIVAEQAEAENLEQRKLAAEQAQREQAEKL
FT                   AIEKANAELLAKQQADAHALQLEQQQRLAEQEAQIRLDQEKAAAEKAEAERLEQTRIAA
FT                   EQAEAERLEQTRIAAEQAEAERLEQARIAAEQAEAERAEAERAEAERAEAERLEQVRIA
FT                   AEQAEAEQLEQQRIADEQAEAERLEQQRIAAEQAEAEHLEQQRIADELASEAAQKVEKP
FT                   KKEGFFSRLKKGLLKTRVNIGSGFASIFSGKKIDDDLFEELETQLLTADLGVDTTMKLI
FT                   DRLTDAANRKQLKDGDALYELMKQEMAVMLKTAEQPLVIPADKKPFVILMVGVNGVGKT
FT                   TTIGKLAKQFQSEGKSVMLAAGDTFRAAAVEQLQVWGERNSIPVIAQHTGADSASVIFD
FT                   AFQAAKARNVDVLIADTAGRLQNKDNLMQELEKIARVMKKIDPDAPHEVMLTIDAGTGQ
FT                   NAISQVNLFNQCVGLTGITLSKLDGTAKGGVIFAVADKFNIPIRYIGVGESIDDLRAFK
FT                   SDDFIDALFSQDEDDA"
     atggcaaaaa aaagtaaatt actgtcttgg ttaggttttg gtaagtcaga taaaaaacaa        60
     caagcggaac aaagtgccca agaggccgat aaccaacagc aagcgcgctt agcagcagaa       120
     aaagctgaag cagagcattt agagcaacag cgactggccg ctgaaaaagc ggagcaagag       180
     gctgcagaaa aaatagcagc ggagcaagca cagagagagc aagccgaaaa gctagcgatt       240
     gaaaaagcca atgctgagtt actcgcaaaa cagcaagccg atgctcatgc attacagcta       300
     gagcaacagc agcgtttagc agagcaagaa gcgcagatgc gtcttgagca agaaaaagca       360
     gcagcagaac aagcagaggc tgagcgttta gagcaagcac gtattgtagc agagcaagct       420
     gaagctgaga atttagagca gcgaaagctt gcagccgagc aagcacagag agagcaagcc       480
     gaaaagctag cgattgaaaa agccaatgct gagttactcg caaaacagca agccgatgct       540
     catgcattac agctagagca acagcagcgt ttagcagagc aagaagcgca gatacgcctt       600
     gatcaagaaa aagcagcagc ggaaaaggct gaagctgagc gtttagagca aacacgtatt       660
     gcagcagagc aagcagaagc tgagcgttta gagcaaacac gtattgcagc agagcaagca       720
     gaggcagagc gtttagagca agcacgcatt gcagcagagc aagctgaagc tgagcgagca       780
     gaagctgagc gagcagaagc tgagcgagca gaagctgagc gtttagagca agtacgtatt       840
     gcagcagagc aagcagaagc tgagcaatta gaacagcaac gtattgcaga tgaacaggca       900
     gaagctgagc ggttagaaca gcagcgtatt gcagcagagc aagctgaagc tgagcattta       960
     gagcaacagc gtattgcaga tgaacttgca agcgaagcag ctcaaaaagt agagaaacct      1020
     aaaaaagaag gttttttctc tcgccttaaa aaaggtttat taaaaactcg cgttaatatt      1080
     ggttctggtt ttgcttccat atttagcggt aaaaaaatag acgatgattt atttgaagag      1140
     ctagaaacgc aattactcac cgccgattta ggcgttgata ccaccatgaa gttaatagac      1200
     cgcctaactg atgcggcaaa ccgtaagcaa ttaaaagacg gtgacgcact ttatgagcta      1260
     atgaaacaag aaatggccgt aatgcttaaa actgcagagc agccgttggt tattccagcc      1320
     gataaaaaac catttgttat attaatggta ggtgttaacg gtgtaggtaa aacgacgacc      1380
     attggtaaat tggctaagca atttcaaagc gaaggcaagt cggtcatgct tgctgcgggt      1440
     gatacattta gagccgcagc ggttgagcaa ctacaagtat ggggcgaacg taatagtatt      1500
     cctgttattg cacagcatac tggtgccgac agtgcgtctg ttatttttga tgcttttcaa      1560
     gcggcaaaag cgcgtaacgt tgacgtatta atcgcagata cagcagggcg cttgcaaaat      1620
     aaagacaact taatgcaaga gcttgaaaaa atagcgcgag taatgaagaa aattgatcct      1680
     gacgcgccgc acgaagtaat gttaactatt gatgcgggca cagggcaaaa tgcaattagc      1740
     caggtaaact tgtttaatca atgcgttggt ttaaccggta ttactctttc aaaactagat      1800
     ggcacggcaa aaggcggtgt tatttttgcg gtagcagata agtttaacat tccaattcgt      1860
     tatattggtg tgggtgaaag tattgatgat ttacgtgcct ttaaaagcga tgactttatt      1920
     gatgcgctat ttagccaaga tgaagacgac gcttaa                                1956
//

If you have problems or comments...

PBIL Back to PBIL home page