(data stored in ACNUC7421 zone)

EMBL: CR954246.FUMC

CR954246.FUMC        Location/Qualifiers
FT   CDS_pept        complement(48132..49508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="PSHAa0048"
FT                   /product="fumarase C (fumarate hydratase Class II)"
FT                   /function="2.1.2.1 : TCA cycle"
FT                   /EC_number="4.2.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9045798, 11133938; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85158"
FT                   /db_xref="GOA:Q3IF10"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF10"
FT                   /protein_id="CAI85158.1"
FT                   /translation="MTQFRTESDSMGELQVPANALYQAQTQRAVNNFAISGLAMPKQFI
FT                   TALAYIKQAAAQSNFELGHLSKTKAKAIEQACQEIIDGSHYEHFPVDIFQTGSGTSSNM
FT                   NANEVIATLASRLGDESIHPNDDVNMGQSSNDVIPTAIALSSAINVVYELLPSLEKLSQ
FT                   HLEHKKAEVGAIVKTGRTHLMDAMPVTFGQTLSAWQTQINHAAAGIRHSLERVCELAQG
FT                   GTAVGTGINADPQFAPLFAKNLSANVGIRFTPSSNFFYNIGSQDAIVALSGQLKVLAVA
FT                   QMKIANDLRWMNSGPLAGLGEIELEALQPGSSIMPGKVNPVIPEAAAMVSAQVIGNDAT
FT                   ITVAGQAGNFELNVMLPVIAYNILQSIELLANSAQALGDKAIASFTVNQLNIDKALAKN
FT                   PILVTALNPVIGYEKAAKIAKQAYKEARPIIDVAEQETDLSRSELEKLLNPSKLTQGGL
FT                   "
     atgactcagt ttagaacaga atcagatagc atgggcgagt tacaagtccc tgctaatgca        60
     ctatatcaag cgcaaactca gcgcgctgtg aataattttg ccatcagtgg tttagctatg       120
     cctaagcagt ttataaccgc ccttgcttac attaaacaag cggcagcgca gagcaacttt       180
     gagcttgggc acctaagcaa aactaaagct aaagcaatag agcaagcatg ccaagaaatt       240
     attgatggta gccattatga gcatttcccg gtcgatatat ttcaaactgg ctcgggtact       300
     agctcaaata tgaatgccaa tgaagtgatt gccactttag caagccggct aggcgatgaa       360
     agcattcatc ctaatgatga tgtaaacatg gggcaaagct ctaacgatgt gatccctact       420
     gccattgccc tgagcagcgc aataaatgtg gtgtacgaat tactcccttc actagaaaaa       480
     ctatcacagc atttagaaca caaaaaagcc gaggttggcg ctatagtaaa aaccggccgc       540
     actcatttaa tggatgctat gccggttact tttgggcaaa ctctaagtgc ctggcaaacg       600
     caaattaacc atgccgcggc tggtataagg catagcctag agcgtgtttg cgaactagcg       660
     caaggtggta ccgctgtagg aacaggtatt aatgccgatc cacaatttgc accgctattt       720
     gctaaaaatc tcagtgccaa cgtaggtatt agatttacgc ctagcagtaa ctttttttac       780
     aatattggtt cgcaagatgc cattgtcgcg ctttcagggc aattaaaagt acttgctgta       840
     gcgcaaatga aaatagccaa cgacttgcgc tggatgaact ctggtccatt agctggttta       900
     ggtgaaatag agcttgaagc actgcaaccc ggatcatcta ttatgcccgg caaagtaaac       960
     ccagtgatcc ccgaagcggc agctatggtg agcgcccaag taattggtaa cgacgctaca      1020
     attaccgttg ccggccaagc aggtaatttt gagctaaatg taatgctgcc tgtaattgct      1080
     tataatattt tacaaagtat agagttactc gctaatagcg cccaagcact gggagataaa      1140
     gccattgcta gctttacagt aaatcagcta aatattgata aggcactggc taaaaatcct      1200
     attttagtaa ccgcgctaaa tccggtgatc ggttatgaaa aagcagccaa aatagcgaaa      1260
     caagcatata aagaagctcg cccaattatt gatgttgccg agcaagaaac tgatttatcg      1320
     cgcagcgagc tcgaaaagct acttaacccc agcaagttaa cccaaggcgg gctgtaa         1377
//

If you have problems or comments...

PBIL Back to PBIL home page