(data stored in ACNUC7421 zone)

EMBL: CR954246.FUSA

CR954246.FUSA        Location/Qualifiers
FT   CDS_pept        237804..239918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="PSHAa0226"
FT                   /product="protein chain elongation factor EF-G,
FT                   GTP-binding"
FT                   /function="3.3.4 : Elongation"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3884371, 11294875, 12369843, 12960150; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85329"
FT                   /db_xref="GOA:Q3ILP5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP5"
FT                   /protein_id="CAI85329.1"
FT                   /translation="MARTTPLERYRNIGICAHVDAGKTTTTERILFYTGLSHKIGETHD
FT                   GAATMDWMEQEQERGITITSAATTCFWKGMDAQFDAHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVLCASSGVQPQTETVWRQANKYEVPRMIFVNKMDRTGADFFAVVDQVKSRLG
FT                   ATPVPIQLPIGAEDGFKGVIDLIKMKAINWNEADQGMTFTYEAIPAELQELADEWRSHL
FT                   VESAAEATEELMDKYLEGEELSEAEIKEALRQRTLANDIVPMTCGSAFKNKGVQAVLDC
FT                   VVEYMPAPTQVKQIQGILEDGTEEERPADDKAPFAALAFKIATDPFVGTLTFFRVYSGT
FT                   VKQGDAVYNPVKSKRERLGRIVQMHSNSREEIKEVFAGDIAAAIGLKDVTTGETLCDPK
FT                   SIITLERMEFPEPVISVAVEPRTIADQDKMGIALGKLAAEDPSFRVQTDEESGQIIISG
FT                   MGELHLDILVERMKREFSVECNVGKPQVAYREAIRSTVKVEGKFIRQSGGRGQYGHVWL
FT                   KLEPMDITDDEAPIYEFVNETVGGSIPKEYVPAVDKGIQEQMSQGVLAGYPLLGVKATL
FT                   YDGSFHDVDSNEMAFKIAGSLAMKQGALQASPVLLEPVMKVEVLTPEANMGDVVGDLNR
FT                   RRGMIEGMEDALGGLKQINAQVPLSEMFGYATDLRSATQGRASYSMEFLKYAEASKHVA
FT                   ETIISARAVI"
     atggcacgta caactccact tgagcgctat cgtaatatcg gtatttgcgc tcacgtagat        60
     gcaggcaaaa ccaccacaac agaacgtatt ctgttttaca caggtctttc tcataagatc       120
     ggtgaaacgc atgatggtgc tgcaactatg gactggatgg agcaggaaca agagcgtggt       180
     atcacaatca cttctgctgc aactacgtgt ttctggaaag ggatggacgc tcaatttgac       240
     gctcatcgta tcaatattat tgatactcca ggacacgttg atttcactat cgaagtagag       300
     cgttctttac gcgtattaga tggtgcggta gttgttcttt gtgcttcatc tggtgtacag       360
     ccgcaaactg agacagtttg gcgtcaagcg aacaaatacg aagttccaag aatgatcttc       420
     gtaaacaaaa tggatcgcac aggcgctgac ttctttgcag ttgttgacca ggtgaaatct       480
     cgtcttggag caacgcctgt tccaattcag ttgccaatag gcgctgaaga cggctttaaa       540
     ggtgttattg acctgattaa gatgaaagct attaactgga acgaagcgga ccagggaatg       600
     actttcactt atgaggcaat accggcagaa cttcaggaat tagccgatga atggcgctct       660
     catttagttg aaagtgctgc tgaagctact gaagaactaa tggataaata cttagagggt       720
     gaagagttaa gtgaagctga aataaaagaa gctttacgcc aacgtacatt agcaaacgac       780
     attgttccta tgacgtgtgg tagcgcattt aaaaacaaag gtgttcaagc agtgcttgat       840
     tgcgttgttg aatacatgcc tgctcctacg caagtgaaac aaattcaagg tatcctagaa       900
     gatggtaccg aagaagagcg tcctgctgat gataaagcgc cgtttgctgc acttgcattt       960
     aaaattgcaa cggacccgtt tgttggcacc ttaacttttt tccgtgttta ctctggtact      1020
     gttaaacagg gtgacgcggt atacaaccca gttaaaagta agcgtgagcg tcttggtcgt      1080
     atcgtacaga tgcattcaaa ctcacgtgaa gagatcaaag aagtcttcgc aggcgacatc      1140
     gcggcggcta ttggtctcaa agacgtaaca acaggtgaaa cactgtgtga tccgaaatcc      1200
     attattacgc ttgagcgtat ggaatttcct gaaccagtaa tctctgttgc ggttgagcct      1260
     cgcacaatcg ctgaccaaga taagatgggg atcgcgctgg gtaaactagc ggctgaagat      1320
     ccatcttttc gtgtacaaac cgacgaagaa tcgggtcaga ttataatatc tggcatgggt      1380
     gaacttcacc tcgatatcct cgtcgaacgt atgaaacgtg aattcagtgt tgaatgtaac      1440
     gttggtaagc cgcaggttgc ataccgagaa gctatccgtt caactgttaa agttgaaggt      1500
     aagtttatac gtcaatcagg tggtcgtggt caatatggtc acgtctggct taaacttgaa      1560
     ccgatggata ttacggatga cgaagcacca atttacgagt tcgttaacga aactgtaggt      1620
     ggttctattc ccaaagaata cgtccctgcg gtagacaaag gcatccaaga gcaaatgtct      1680
     caaggtgtgc tggcaggcta cccattactt ggcgttaaag cgactttata tgatggttca      1740
     ttccatgatg tagactcgaa tgaaatggca tttaaaatag caggttcatt ggcaatgaag      1800
     caaggcgcgc tgcaagcgag cccggtactt ttagagccag taatgaaggt tgaagtactc      1860
     actcctgaag caaacatggg tgatgtagtt ggtgacttaa accgtcgccg cggcatgatc      1920
     gaaggcatgg aagatgcatt aggtggactg aagcaaatta atgcacaggt tcccctttct      1980
     gaaatgtttg gttatgctac tgacttacga tctgcaacac agggtcgtgc ttcatactct      2040
     atggagtttt tgaagtacgc cgaagcatcg aaacatgttg cagagacaat aatttcagct      2100
     cgcgctgtaa tatga                                                       2115
//

If you have problems or comments...

PBIL Back to PBIL home page