(data stored in ACNUC7421 zone)

EMBL: CR954246.GALE

CR954246.GALE        Location/Qualifiers
FT   CDS_pept        complement(488463..489476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="PSHAa0469"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /function="2.1 : Metabolism of carbohydrates and related
FT                   molecules"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /function="2.1.3.5 : Biosynthesis and degradation of
FT                   polysaccharides"
FT                   /EC_number="5.1.3.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1956282, 3022232; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85566"
FT                   /db_xref="GOA:Q3IFQ0"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ0"
FT                   /protein_id="CAI85566.1"
FT                   /translation="MTILVTGGAGYIGSHTVLELLQQNSNVVVIDNLSNSSSESLTRVK
FT                   KITGKEVTFYQGDILDKAFLDSVFAKHTIESVIHFAGLKAVGESVVKPIEYYQNNVQGT
FT                   LTLVDAMRDAGVFKLVFSSSATVYGDPASLPIKEDFPVGGTTNPYGTSKLMVEMMLQDI
FT                   AKSDERFAFAILRYFNPVGAHESGLIGEDPNGIPNNLLPYISQVAVGKLKQLAVFGDDY
FT                   DTVDGTGVRDYIHVVDLALGHLKALNKIATNTGALVYNLGTGNGYSVLQMVNAFIKASG
FT                   QAVPYQVSPRRPGDIAACYAAPEKALNELDWQAMRGIDTMMQDTWRWQSNNPNGYK"
     atgactattt tagtaaccgg tggcgcaggc tatattggct cgcacactgt tttagaactt        60
     ttacaacaaa acagtaatgt tgttgttatt gataatttaa gcaactcatc atcagagtca       120
     cttacgcgcg ttaaaaaaat taccggtaaa gaagtaactt tttaccaagg tgatattctc       180
     gataaagcat ttttagactc agtatttgct aagcatacta ttgaaagcgt aattcacttt       240
     gctggcttaa aagcggtggg tgagtcggtt gtaaaaccaa ttgagtacta tcaaaataac       300
     gtacaaggta cattaacact agttgatgcg atgcgcgatg cgggtgtatt taagttagta       360
     tttagctcat cagcaaccgt ttatggcgac ccagcaagct tacctattaa agaagacttt       420
     cctgttggtg gcaccaccaa cccttatggc acatcaaagt taatggttga aatgatgttg       480
     caagatatcg caaaatcaga cgagcgcttt gcctttgcta ttttgcgtta ctttaatcca       540
     gtaggcgcgc atgaatcggg gttaattggc gaagatccga acgggatccc taataattta       600
     ttaccgtata tttcacaagt tgccgtgggc aagctcaagc aactagccgt atttggcgat       660
     gattacgaca cagtagatgg caccggcgtg cgcgactaca ttcacgtagt cgatttagct       720
     ttaggacatt taaaagcgct gaataaaatt gccacaaaca ccggtgcatt ggtttataac       780
     ctaggtacag gcaacggtta ttcagtactg caaatggtga acgcctttat taaggccagt       840
     gggcaagcag taccatatca agtgtcacca cgtcgtccag gcgatatagc cgcttgttac       900
     gcagctcctg aaaaagccct gaatgaacta gactggcaag cgatgcgcgg tatcgatact       960
     atgatgcaag acacctggcg ctggcagtca aataacccaa atgggtataa gtag            1014
//

If you have problems or comments...

PBIL Back to PBIL home page