(data stored in ACNUC7421 zone)

EMBL: CR954246.GLNA

CR954246.GLNA        Location/Qualifiers
FT   CDS_pept        complement(174662..176068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="PSHAa0166"
FT                   /product="glutamine synthetase"
FT                   /function="2.2.1.3 : Glutamate family"
FT                   /EC_number="6.3.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2882477, 6148334, 2858855; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85270"
FT                   /db_xref="GOA:Q3IFL0"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL0"
FT                   /protein_id="CAI85270.1"
FT                   /translation="MSQSVLDFIKENDVKFIDLRFTDTKGKEQHISIPHHQIDEDFFED
FT                   GKMFDGSSIAGWKGINESDMVLMPVAESAKLDPFTEEATLIIRCDVVEPSTLQGYERDP
FT                   RSVAKRAEEYMRSTGIADTVLFGPEPEFFVFDDVKYKTDMSGSMYKIDSKQAAWNSDKE
FT                   YADGNTGHRPGVKGGYFPVAPVDDFQDWRSATCLVLEEMGQVVEAHHHEVATAGQNEIA
FT                   TRFNTMVIKADEIQEMKYVIHNMAHLYGKTATFMPKPIVGDNGSGMHCHQSLAKDGVNL
FT                   FAGDKYGGLSEDALYYIGGIIKHAKAINAFANASTNSYKRLVPGYEAPVMLAYSARNRS
FT                   ASIRIPVVPSAKGRRIEVRFPDATANPYLAFAAMLMAGLDGIKNKIHPGDAMDKDLYDL
FT                   PAEEAAEIPTVASSLEEALASLDADREFLNQGDVFSNDLIDAYIKLKSQEVEKLNMTTH
FT                   PIEFEMYYSC"
     atgtcgcaat cggttttaga ttttattaaa gaaaatgacg ttaagttcat tgatttacgc        60
     tttactgata caaaaggtaa agagcagcat atttcaattc ctcatcacca aattgatgaa       120
     gacttttttg aagatggtaa aatgttcgat ggttcttcaa ttgctggctg gaaaggcata       180
     aacgaatcag acatggtgct aatgcctgtt gctgaatcag ctaagcttga cccattcact       240
     gaagaagcca cattaattat acgttgtgac gtagtagagc cttctacatt acaaggttac       300
     gagcgcgatc cacgctctgt agcaaagcgt gctgaagagt atatgcgctc tacaggtatt       360
     gctgatacgg ttttatttgg cccagagcca gagttcttcg tatttgatga cgtaaaatat       420
     aaaacagaca tgtctggctc tatgtacaaa atcgattcta agcaagctgc ttggaactca       480
     gataaagaat acgcagacgg caatacaggt catcgtcctg gcgttaaagg cggttacttc       540
     ccagttgctc ctgttgatga ctttcaagat tggcgctctg ctacttgtct agtattagaa       600
     gaaatgggac aagttgttga agcacaccat cacgaagtag caactgcagg acaaaacgaa       660
     attgctacgc gctttaatac tatggtgatt aaagccgatg aaattcaaga aatgaagtat       720
     gttattcata acatggctca tttatacggc aaaacagcca cttttatgcc taaacctatt       780
     gttggcgata acggctctgg tatgcattgt catcagtcgt tagctaaaga cggtgttaac       840
     ttatttgcag gtgataagta cggcggtctt tctgaagatg cgctttatta cattggcggt       900
     attattaaac atgctaaagc aattaatgcg tttgctaatg cctctactaa ctcgtacaaa       960
     cgtttagtac caggttacga agcaccagta atgcttgcat actctgcacg taaccgttct      1020
     gcatcgattc gtattccggt agtaccatca gctaaaggtc gtcgtattga agtacgcttc      1080
     cctgatgcaa cggctaaccc gtatcttgct tttgctgcca tgcttatggc tggccttgat      1140
     ggaattaaaa ataaaatcca tcctggtgat gcaatggata aagatttata cgacctacct      1200
     gcagaagaag cagcagaaat tccaaccgtt gcctcttcat tagaagaagc actggcatct      1260
     cttgatgctg accgtgagtt tttaaatcaa ggtgacgtgt tctctaatga tttaattgat      1320
     gcttacatta aacttaagag tcaagaagtt gaaaaactta acatgacaac gcacccaatt      1380
     gagtttgaaa tgtattacag ctgttaa                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page