(data stored in ACNUC7421 zone)

EMBL: CR954246.GLNL

CR954246.GLNL        Location/Qualifiers
FT   CDS_pept        complement(172862..173932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /locus_tag="PSHAa0164"
FT                   /product="nitrogen availability sensory kinase (soluble) in
FT                   two-component regulatory system with GlnG, nitrogen
FT                   regulation (nitrogen regulator II, NRII)"
FT                   /function="1.3 : Sensors (signal transduction)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11121068, 12562801; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85268"
FT                   /db_xref="GOA:Q3IFL2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL2"
FT                   /protein_id="CAI85268.1"
FT                   /translation="MLNNTHFSPELLNAIWQNQTTAVMLLNESFTLIYANTSTSELLGL
FT                   GTKRLLGQSFDDLFNYHSIDLKRIAQYSLIDGVDCHQHRADVVFVDSRHAKLAVSSKQI
FT                   KYQGALYILLECRQTDDEIKFDQASNQMHQYQAARNLIRGLAHEIKNPLGGIRGAAQLL
FT                   QYEVDQQERNECAELIIEQADRLRELVDRLLGPNQLPQKSYGNIHQTLESVIKLSTLDN
FT                   SDNIRLVKDYDPSIPDVYIDQSKVQQVVLNIVRNAQQALVNGGEIKIKTRINYQHRRPG
FT                   KAPKKALLIQVLDNGPGIDISVRDTLFYPMITNKDGGSGLGLSIAQTLIDQHNGYIECD
FT                   SWPGHTEFNIYLPFAD"
     atgcttaata acacacactt tagccctgag ctactcaatg ccatatggca aaatcaaacc        60
     actgccgtga tgcttttaaa cgaaagcttt acgcttattt atgccaatac cagtaccagt       120
     gagctgcttg gtttaggcac taagcgttta ttagggcagt cttttgatga tttatttaac       180
     taccattcaa tcgatttaaa acgcatagcg caatactctt taattgatgg cgtagattgc       240
     caccagcata gggctgacgt ggtatttgtt gattctcgcc atgctaaatt agcagtcagt       300
     tcaaaacaga taaaatacca aggtgcactt tatattttat tagaatgtcg gcaaaccgat       360
     gatgaaatta aattcgatca agcatcaaat caaatgcacc aataccaagc cgcacgtaat       420
     ttaattcgag gtttagcgca cgaaattaaa aaccctttag ggggaattcg cggagcggcg       480
     cagttattgc aatacgaggt agaccagcaa gaaagaaatg aatgtgccga gcttattatt       540
     gagcaagccg accgattgcg tgaattagta gatagactgc ttgggcctaa ccaattaccg       600
     caaaagtctt atggcaatat acatcaaacc ttagagtcgg tgatcaaatt aagtacccta       660
     gataatagtg acaatattcg cttggtaaaa gattacgatc cgagtattcc cgatgtttat       720
     attgaccaaa gtaaagtgca gcaagtggtg cttaatattg tgcgtaatgc ccagcaggca       780
     ttagttaatg gtggggaaat aaaaattaaa acccgaatta actatcagca ccgccggccc       840
     ggtaaggcac ccaaaaaagc cttgttaatt caagtgctcg ataatggccc agggattgat       900
     attagtgtac gcgatacttt gttttatcct atgatcacta ataaagatgg cggctctgga       960
     ttggggcttt ctatagcgca aacattaatt gatcaacaca atggttatat tgagtgcgat      1020
     agctggcctg gtcacaccga atttaatatt tatctgcctt ttgcagatta a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page