(data stored in ACNUC7421 zone)

EMBL: CR954246.GLPD

CR954246.GLPD        Location/Qualifiers
FT   CDS_pept        complement(199352..200890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="PSHAa0189"
FT                   /product="sn-glycerol-3-phosphate dehydrogenase FAD
FT                   binding; dioxygen as acceptor"
FT                   /function="2.1.3.2 : Sugar alcohols"
FT                   /EC_number="1.1.99.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11955283; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85292"
FT                   /db_xref="GOA:Q3IK60"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK60"
FT                   /protein_id="CAI85292.1"
FT                   /translation="MPSLKLIKRYSVKLLDNEYDLLVIGGGVNGTGIAADAAGRGLKVL
FT                   LCEQNDLASATSSSSSKLIHGGLRYLEHYQFRLVKEALKEREVLLKNAPHIMWPLSFRL
FT                   PHQAHLRPYWMIRIGLFIYDHLAKRITLPASKSIKFTRDSILNNTITRGFEYADGWVDD
FT                   SRLVILNALAAQQKGATILSRTRCIKAVRNNNNWSVTLEQQGSKKQCSIVAKGVVNAAG
FT                   PWVASLFDEVITGPSPHNIRLVKGSHIIVPRIHTEPQAYILQNKDQRIIFVTPFEDDYS
FT                   LIGTTDEEYSDNIADVKISDKEVDYLISITNNYFKKQLTHNDIVHTFSGVRPLLDDNSC
FT                   DAQAVTRDYKLILSSNNNQAPLLSVFGGKITTYRKLAENAVNELASFYPHMGQTWTKNT
FT                   PLPGGDFSSKVVLKQQLQVKYAWLPEFILNRFIRSYGTGTYTLLTDAQSVADLGQHFGH
FT                   GLYATEVNYLVNSEWASSAEDILWRRSKLGLRFNTEQITALSQYIQNYNGSIPL"
     atgccatcgc ttaaattaat aaagaggtat tcagtgaaat tactcgataa tgaatatgat        60
     ttactggtta ttggcggtgg cgttaatggc actggtattg cggctgacgc cgccggtaga       120
     ggcttaaaag tattactgtg tgagcaaaat gatttagcct ctgctacatc atcaagtagc       180
     agtaaactta ttcatggtgg actacgctat ttagagcatt accaatttag gctagtaaaa       240
     gaggcactta aagagcgtga agtgttatta aaaaatgccc cacatattat gtggccgcta       300
     tcttttaggc tgccacatca agcgcattta cgcccttact ggatgattag aattgggttg       360
     tttatatacg accatcttgc caaacgcatt actttacccg catcaaaatc aattaaattt       420
     acccgcgata gtatattgaa taatactatt acccgcggtt ttgaatacgc tgatggctgg       480
     gttgatgatt cgaggttagt tattttaaat gcgttagcag cacagcaaaa aggtgcaacc       540
     attttaagcc gcacgcgctg tattaaagca gttcgcaata acaataattg gagtgtgacc       600
     ttagagcaac aaggtagcaa aaagcaatgt tctatagttg ctaaaggagt tgttaatgca       660
     gcgggccctt gggttgcatc actttttgat gaggtaatta ctgggccgtc gccacataat       720
     attcgcttag ttaaaggcag ccatattatt gtgccgcgta ttcacactga gccgcaggcc       780
     tatattttac aaaataaaga tcagcgtatt atttttgtta ccccatttga agatgactat       840
     tcactgattg gcactacaga tgaagaatac agcgacaata tagcagatgt aaaaattagc       900
     gataaagaag tcgattactt aattagcatt actaataatt actttaaaaa acaacttact       960
     cataacgaca tagtgcatac ctttagtggt gtacgcccct tactagatga taactcatgc      1020
     gacgcacaag ccgttactcg cgactacaaa ctgatattat cgagcaataa taaccaggca      1080
     ccactgctaa gtgtatttgg tgggaaaatc accacttatc gcaagctcgc tgaaaacgca      1140
     gtaaacgaac tcgccagctt ttatccgcat atgggccaaa catggacaaa aaacactcca      1200
     ttacccggtg gcgacttttc atcaaaggta gtattaaagc aacaactaca ggtaaagtac      1260
     gcatggttgc ctgagtttat tttaaatcgc tttatacgca gttacggtac tggcacttat      1320
     accctactta cagatgccca aagcgtagct gatttaggcc agcattttgg ccatggttta      1380
     tacgccactg aagtaaatta tttagttaat agcgagtggg ctagcagcgc cgaggatata      1440
     ttgtggcgtc gtagtaagtt aggtttgcgt tttaatactg agcaaataac agcgctgagc      1500
     cagtatattc aaaattataa tggctcaata ccgctgtaa                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page