(data stored in ACNUC7421 zone)

EMBL: CR954246.GLPK

CR954246.GLPK        Location/Qualifiers
FT   CDS_pept        complement(200916..202421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="PSHAa0190"
FT                   /product="glycerol kinase"
FT                   /function="2.1.3.2 : Sugar alcohols"
FT                   /EC_number="2.7.1.30"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85293"
FT                   /db_xref="GOA:Q3IK59"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK59"
FT                   /protein_id="CAI85293.1"
FT                   /translation="MSKYILSIDQGTTSSRAILFTKDAKVVDTVQQTFPQHFPNNGWVE
FT                   HDPNDILQTVLSTCKTVLANNQVTAEQVIAIGITNQRETTLVWNKKTGQPIYNAIVWQD
FT                   RRTSEYCEQIRSDKLSKKISDKTGLLLDPYFSATKIRWILDNVTDAQQQALAGELAFGT
FT                   VDSYLLWHLTAGKVHRTDATNASRTLLFNIHQQCWDEELLTQFNIPHSMLPEVMDSAAE
FT                   FGSTSSEIFGAPIKICAMAGDQQAALIGQACFKEGMAKSTYGTGCFLMLNTGDKALTSN
FT                   NRLLTTVAYRLNGRVTYAIEGSIFMAGATMQWIVEGLKLLEHAGDSEAMVKDVPLDHGV
FT                   FLVPSFTGLGAPYWDANARGAILGLTRDSGISTIVAAALQSVGYQTKDLQKAMEGDGLR
FT                   PSILRVDGGMAKNNWAMQFLANILGASVERPALTETTSLGVAYLAGLQTGIYKSTEQLA
FT                   TMWQCDRRFEPTMSIDERNDLYAKWQHCIAQVTLSNNATKDDC"
     atgtctaaat acatactctc gattgatcaa ggaactacca gctctcgggc tattttattt        60
     accaaagatg ccaaggtagt tgatactgtt cagcaaacat tcccgcagca ctttcccaat       120
     aatggctggg ttgagcacga ccctaacgat attttacaaa ccgtactaag tacctgtaaa       180
     acagtactgg ctaataacca ggttacagcc gagcaggtca ttgccattgg tatcactaat       240
     cagcgcgaaa ccactttagt atggaataaa aagactggcc aaccaattta taatgccatt       300
     gtgtggcaag atcgccgtac cagcgagtat tgcgagcaaa tacgtagcga taaactcagt       360
     aaaaaaatta gcgataaaac cgggctatta ttagatccgt acttttcagc cactaaaatt       420
     cgctggattt tagataatgt taccgatgca cagcaacaag cgctagccgg cgagctagca       480
     tttggtacgg ttgacagtta tttactgtgg catttaaccg ctggcaaagt acaccgtact       540
     gatgccacca acgcctcacg tacactatta tttaatatac atcagcaatg ttgggatgaa       600
     gagttactaa cgcagtttaa tattccacac tctatgcttc cagaagtgat ggacagcgca       660
     gccgagtttg gcagtaccag cagtgaaatt tttggtgcac cgattaaaat ttgcgctatg       720
     gcgggggatc agcaagccgc attaattggc caagcttgct ttaaagaagg catggctaaa       780
     agtacctacg gaacgggctg ctttttaatg cttaatacgg gcgataaagc ccttacctct       840
     aataaccgct tattaactac tgtggcttac aggctcaatg gtagagtgac ctacgctata       900
     gagggcagta tttttatggc gggtgccact atgcaatgga ttgttgaggg cttaaagcta       960
     cttgaacatg ccggcgacag cgaggctatg gtcaaagacg tgccactgga tcacggcgta      1020
     tttttagtgc cttcgtttac cggtttaggc gccccatact gggatgccaa tgcccgtggt      1080
     gctattttag gtttaacccg tgattctggc attagcacta tagtagcagc ggcgctgcag      1140
     tctgttggct atcaaaccaa agatttacaa aaagccatgg aaggtgatgg cctgcgtcca      1200
     agtattttgc gcgtggacgg tggcatggca aaaaataatt gggccatgca gtttttagct      1260
     aatattttag gcgcaagtgt ggaacgccca gcgctaacag aaacaacctc tctgggtgtt      1320
     gcctatttag cggggctgca aactggaatt tataagtcaa cggagcaatt agctactatg      1380
     tggcaatgcg accgtcgttt tgaaccaacc atgagcatag atgaacgtaa cgacttatac      1440
     gcaaaatggc agcactgtat agcacaagtc acgctttcaa ataacgcaac aaaagacgac      1500
     tgctaa                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page