(data stored in ACNUC7421 zone)

EMBL: CR954246.GLYQ

CR954246.GLYQ        Location/Qualifiers
FT   CDS_pept        6349..7251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="PSHAa0005"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7556056, 12572618; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85119"
FT                   /db_xref="GOA:Q3IDE6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDE6"
FT                   /protein_id="CAI85119.1"
FT                   /translation="MQKYDVKTFQGLILALQDYWAQQGCVIIQPLDMEVGAGTFHPQTF
FT                   LKSIGPEPMSSAYVQPCRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLAA
FT                   VGIDTLTDEVRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECSPVTGEI
FT                   TYGLERLAMYIQGVDSIYDLVWADGPLGRVTYGDVFHQNEVEQSTYNFEHANVEDLFAQ
FT                   FDKCEAESQKLIEANLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRALSKAC
FT                   AQSYYDKREALGFPLCKDK"
     atgcaaaaat atgacgttaa aacctttcaa ggtttgatcc tggctttaca ggattattgg        60
     gcgcagcaag gctgcgttat tattcaacca cttgatatgg aagtgggcgc tgggacattc       120
     cacccgcaaa catttttaaa atcgattggc ccagagccaa tgtcgagtgc atacgtacaa       180
     ccgtgtcgac gacctaccga tggccgttac ggcgaaaacc caaaccgctt acagcattat       240
     taccagtttc aggttgtgct aaagccttcg ccagataata ttcaagagct ttatttaggc       300
     tctttagcgg ccgtaggcat agatacctta acagacgaag tgcgctttgt tgaagacaac       360
     tgggaatcac ctaccttagg tgcgtggggc ctaggttggg aaatttggtt aaacggcatg       420
     gaagtaaccc agtttaccta ctttcaacaa gtgggcggca ttgagtgctc accggtaact       480
     ggcgaaatca cttacggcct agagcgttta gccatgtata ttcagggcgt agacagtatt       540
     tacgacctag tttgggctga tggtccgctt gggcgagtaa cttacggcga tgtgtttcat       600
     caaaatgaag tagaacaatc tacttataac tttgagcacg ccaacgtaga agatctattt       660
     gctcagtttg ataaatgtga agcagagagc caaaagttaa ttgaagcaaa cttaccgtta       720
     ccggcttatg agcaagtaat gaaggcatcg catgcattta acttattaga cgcgcgccac       780
     gcaatttcgg taaccgaacg ccaacgttac atactacgcg ttcgtgcttt atcaaaagcg       840
     tgtgcacaaa gttattatga taaacgtgaa gcgcttggtt tcccgctgtg taaggataag       900
     tag                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page