(data stored in ACNUC7421 zone)

EMBL: CR954246.GLYS

CR954246.GLYS        Location/Qualifiers
FT   CDS_pept        7254..9323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="PSHAa0006"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6374618, 7556056, 8944770; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85120"
FT                   /db_xref="GOA:Q3IJ28"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ28"
FT                   /protein_id="CAI85120.1"
FT                   /translation="MSAQNLLVEIGTEELPPKALRKLAEAFAANLTAELETLELAHQGV
FT                   SWYASPRRLGLRVIALDAKQQDKEVEKRGPAIKAAFDADGNPTKAAMGWARGCGIEVKD
FT                   AQTLETDKGAWLLHLAKVAGQETKTLMVDVINKALAKLPIPKPMRWGANKTQFIRPVHT
FT                   VTILLGDELVTGEVLGKQVSNQLQGHRFHHPEKITINHADDIFDVLKSAYVIADYEQRK
FT                   AQIRAQIEAAAKAINAVVAMDEDLLEEVTSLVEWPVTLTATFEEEFLAVPAEALIYTMK
FT                   DDQKYFPLLDQNGKLLNKFLFVSNIESKDPSVVISGNEKVVRPRLADAQFFFESDKKKT
FT                   LESRLESLDSVLFQKQLGTLKDKSARISELAGYIAQQLGADKELAQRAGLLSKTDLMTE
FT                   MVMEFTDIQGVMGMHYARFDGEAEDVALAQNEQYMPRFAGDSLPTNLISCAVAIADKFD
FT                   TLVGIFGIGQAPKGDKDPFALRRAAIGALRIMVEKELPLDILDLVAKSQTLFGDKLTNL
FT                   NVSTDVFEFMLGRFRAWYQDEGIEVDVIQAVLARRPTKPVDFDRRVKAVSHFRTLDAAE
FT                   ALAAANKRVSNILAKNDITSEGNVDESLLTDDAEKVLAAQVAKFATELAPLYASGNYQE
FT                   ALSQLAGIRQSVDSFFDNVMVMADDEAVKQNRLALLSQLSGLFLGIADISVLQK"
     atgtcagcac aaaacttatt agtagaaatt ggcaccgaag agttgccacc aaaagcgctg        60
     cgtaaattag cagaagcatt tgctgcaaac ttaactgcag aactagagac attagaatta       120
     gcgcatcaag gcgtaagctg gtatgcatca ccacgtcgtt taggccttcg cgtaatagcg       180
     cttgatgcaa aacaacaaga taaagaagta gaaaaacgcg gcccagcaat taaggcagcg       240
     tttgatgcag acggcaatcc tactaaagct gcaatgggtt gggcacgtgg ttgtggtatt       300
     gaagtaaaag atgcgcaaac acttgaaacc gacaaaggcg cgtggttgct gcaccttgct       360
     aaagtagcag ggcaagaaac taaaacgctg atggttgacg ttattaataa agcgctggct       420
     aaattaccta ttcctaagcc aatgcgttgg ggcgcgaata aaacacaatt tattcgtcca       480
     gtgcatacgg taactatttt attgggtgat gagttagtaa caggtgaagt gctgggtaag       540
     caggtaagta atcagcttca aggacatcgc tttcatcatc ctgaaaaaat taccattaac       600
     catgctgatg atatttttga tgttttaaaa tcagcctacg ttattgccga ttacgagcag       660
     cgtaaagcgc aaattcgagc gcaaatagaa gctgcagcaa aagcaataaa tgcggttgta       720
     gccatggatg aagatttact tgaagaagta acatcactgg tagaatggcc agtaacatta       780
     acggctacat ttgaagaaga gtttttggca gtaccggccg aagcgcttat ttacacgatg       840
     aaagacgatc aaaaatactt tccgctttta gatcaaaacg gcaaactttt aaataagttt       900
     ttgtttgtgt ctaacataga aagtaaagat cctagcgtag tgatttcggg taacgaaaaa       960
     gtagtgcgtc ctcgattagc cgatgcgcaa ttcttttttg aaagcgataa aaagaaaaca      1020
     ctagaaagcc gtttagaatc tctcgatagc gtattgttcc aaaaacagtt aggtacactt      1080
     aaagacaagt ctgcgcgtat tagcgagctt gccggttata ttgcccagca acttggtgca      1140
     gataaagagc tagcacaacg tgctggttta ttgagtaaaa ctgacttaat gaccgaaatg      1200
     gtgatggaat ttaccgacat ccaaggtgtt atgggaatgc attacgcacg ttttgacggc      1260
     gaagctgaag atgtagcact agcgcagaat gagcaatata tgccacgctt tgcaggcgac      1320
     agcttaccta ccaacttaat tagttgcgca gtagcgattg ccgataagtt tgatacctta      1380
     gtgggtatct ttggcatagg ccaagcgcca aaaggcgaca aagacccatt tgctttacgc      1440
     cgtgctgcta ttggcgcatt gcgcatcatg gtagaaaaag agctaccgct tgatatttta      1500
     gacctagttg ctaaatcgca aaccttgttt ggcgataagc taactaatct taatgtatca      1560
     accgatgtgt ttgagtttat gctagggcgt ttccgtgctt ggtatcaaga cgaaggaata      1620
     gaagtagatg tgattcaagc tgtgcttgca cgtcgtccga ctaaacctgt tgattttgat      1680
     cgccgtgtta aagccgtaag ccactttcgc acattagacg cagcagaagc acttgcagcc      1740
     gctaataagc gcgtaagtaa tatacttgct aaaaacgaca ttaccagcga aggtaatgta      1800
     gatgaaagct tactaaccga cgacgctgaa aaagtacttg cggcacaagt agcaaaattt      1860
     gctactgaac ttgcaccact ttacgccagt ggtaattacc aagaagcatt aagccaattg      1920
     gctggtattc gtcaaagtgt tgatagcttt tttgataacg tgatggttat ggccgacgac      1980
     gaagcagtta agcaaaatcg tctggcgctt ttaagtcagt taagcggatt gtttttaggt      2040
     attgcagaca tttctgtact acaaaaataa                                       2070
//

If you have problems or comments...

PBIL Back to PBIL home page