(data stored in ACNUC7421 zone)

EMBL: CR954246.GOR

CR954246.GOR         Location/Qualifiers
FT   CDS_pept        complement(374336..375697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="PSHAa0360"
FT                   /product="Glutathione reductase"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /EC_number="1.8.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3521741; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85458"
FT                   /db_xref="GOA:Q3IIA8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA8"
FT                   /protein_id="CAI85458.1"
FT                   /translation="MAQHFDYIAIGGGSGGIASANRAAMRGAKVALIEAKHMGGTCVNV
FT                   GCVPKKVMWHGAQVAEAINLYAPDYGFNVEVKGFDWGKLVESREAYIGRIHKGYDNGLA
FT                   NNGVTVIKGFAKFVDNKTVEVDGEHYTADHILIAVGGRPSIPNIEGAEHGIDSNGFFEL
FT                   KEQPKRVAVIGAGYIAVELAGVLHSLGTDTHLFVRKHAPLRNFDPYIIDTLVEVMAKEG
FT                   PTLHTESVPHKLVKEDDGSVTLHLDNGKSHNVDQVIWAIGREPTTNAINIAAAGVEVNS
FT                   KGFVKVDEYQNTTAKNVYAVGDIIENGIELTPVAVKAGRTLSERLFNKELPDDLKMDYS
FT                   LVPTVVFSHPPIGTIGLTEQEAISQYGAENVKVYQSAFAAMYTAVTQHRQPCKMKLVCA
FT                   GPDEKVVGLHGIGFAVDEMIQGFAVAMKMGATKADFDAVVAIHPTGSEEFVTMR"
     atggctcagc attttgatta tattgcaatt ggcggtggta gcggcggtat tgcgtcggca        60
     aaccgtgcgg caatgcgtgg cgctaaagta gcacttattg aagcaaagca tatgggtggc       120
     acatgtgtaa acgtaggatg tgtacctaaa aaagtaatgt ggcatggtgc tcaagttgct       180
     gaagcaatta atttatatgc gcctgattac ggatttaatg ttgaagtaaa aggttttgat       240
     tggggcaaat tagtagaaag ccgcgaagcc tacattggcc gaatccataa aggttacgat       300
     aatggccttg caaacaacgg cgttaccgta attaaaggtt ttgctaaatt tgtagataat       360
     aaaacagttg aagtagatgg tgagcattat actgctgatc atattttaat tgctgttggc       420
     ggtcgtccaa gcattccaaa cattgaaggt gctgagcacg gcattgactc taatggcttt       480
     tttgagctta aagagcaacc taaacgcgtt gctgttattg gcgcaggtta cattgctgta       540
     gagcttgcag gcgtactaca tagcttgggc actgacacgc atttatttgt gcgtaaacac       600
     gcaccactgc gtaactttga cccatatata atcgatacgc tagttgaagt aatggcaaaa       660
     gaaggcccta cgctgcatac cgaatctgta ccacataagt tggttaaaga agacgacggc       720
     tcagtaacct tgcatttaga taatggtaaa agccataacg tagaccaagt aatttgggct       780
     attggccgcg agccaaccac aaatgcaatt aatattgctg cagcaggcgt agaagttaac       840
     agcaaaggtt ttgttaaagt agacgagtac caaaatacca cagctaaaaa cgtatacgct       900
     gtgggcgaca ttatcgaaaa cggcattgag cttaccccag tagcagttaa agctgggcgt       960
     actttatctg agcgcttatt taataaagaa ctgccagatg atttaaaaat ggattacagc      1020
     ttagttccta cagtagtatt tagtcatcca cccattggta ctattggctt aacagagcaa      1080
     gaagctatat cgcaatacgg tgcagaaaac gtaaaagtat accaatcagc ttttgccgct      1140
     atgtataccg cggttacgca acatcgccag ccttgtaaaa tgaagctagt gtgcgcaggt      1200
     ccagatgaaa aagtagttgg cctacatggt ataggttttg ctgtagacga aatgattcaa      1260
     ggttttgctg tcgccatgaa aatgggcgct actaaagctg actttgatgc tgtggttgct      1320
     atacacccga ctggctcaga agagtttgta acgatgcgct aa                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page