(data stored in ACNUC7421 zone)

EMBL: CR954246.GPMM

CR954246.GPMM        Location/Qualifiers
FT   CDS_pept        complement(382408..383952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmM"
FT                   /locus_tag="PSHAa0366"
FT                   /product="phosphoglycerate mutase III,
FT                   cofactor-independent"
FT                   /function="2.1.1.1 : Glycolysis/gluconeogenesis"
FT                   /EC_number="5.4.2.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85464"
FT                   /db_xref="GOA:Q3IIE4"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIE4"
FT                   /protein_id="CAI85464.1"
FT                   /translation="MSEHKKPLVLMILDGWGYREDEQSNAILAANTPVLDELWATRPRT
FT                   LISASGFDVGLPDGQMGNSEVGHVNLGAGRVVYQDFTRITKAINDGEFDSTPALVDNID
FT                   KAVSADKAVHIMGLLSPGGVHSHEDHIVASIELAAKRGAKEVYFHGFLDGRDTPPRSAK
FT                   ASIERIEAVFAKLQCGRLASLIGRYYAMDRDNRWNRVEKAYNLLTLAQGDFSYPTGVSA
FT                   LEAAYERDENDEFVAASTITPAGAEPVQINDGDTVIFANFRADRAREITRAFVEPNFDG
FT                   FAKQKSPALSAFVMMTEYAADIDAPVAFGPTPLVNVLGEWFEKHGKTQLRISETEKYAH
FT                   VTFFFSGGREDEFNGETRELIPSPQVATYDLQPEMNSEMLTDKLVAAIKSGKYDAIICN
FT                   YPNGDMVGHSGVFAAAVKACEAVDHCIGRVVAALNKYGGEALITADHGNAEQMANLKTG
FT                   QAHTAHTSEPVPFIYVGRDATASEGKALSDVAPTMLHLMGMEQPTEMTGKPIMTLK"
     atgtcagagc ataaaaaacc actggtatta atgattttag atggctgggg ataccgcgaa        60
     gatgagcaaa gtaatgcgat tctggctgca aacacccctg tattagatga attatgggcc       120
     acccgcccgc gcacattaat ttcagcttcg ggttttgatg taggccttcc tgatggtcaa       180
     atgggtaact ctgaagttgg ccacgttaat ttaggcgctg ggcgcgttgt ttatcaagac       240
     tttactcgta taacaaaagc gataaacgat ggcgagtttg actccactcc tgcactagtc       300
     gataacatag ataaagccgt aagtgcagat aaagccgtgc acattatggg gctattaagc       360
     ccaggcggcg tacatagcca cgaagatcat attgtggcaa gtattgaact tgctgcaaaa       420
     cgcggtgcaa aagaggtgta ctttcatggc tttttagatg gccgcgatac tcctccacgc       480
     agtgctaaag cttctattga acgtattgaa gcagtatttg caaagctaca atgtggccgc       540
     ttagcatcgc taattggccg ttattacgca atggacagag acaaccgctg gaaccgcgta       600
     gaaaaagcct ataacttact tacgttagca caaggcgact ttagctaccc gactggcgtg       660
     agcgcacttg aagcagctta tgagcgcgac gaaaacgatg agtttgtagc cgcaagcacc       720
     attactcctg caggcgcaga gcctgtacaa attaacgatg gcgacacggt tatatttgct       780
     aactttagag ccgatcgcgc ccgtgaaatt acacgtgcat ttgttgagcc taactttgac       840
     ggttttgcca aacaaaagtc acccgctctt agcgcatttg taatgatgac cgaatacgct       900
     gcagatatag acgccccggt tgcatttggc cccacgccac tggtaaacgt acttggcgaa       960
     tggtttgaaa aacacggtaa aactcaacta cgtatttctg aaaccgaaaa atacgcccac      1020
     gttacgtttt tctttagtgg tggccgcgaa gacgaattta acggtgaaac ccgcgaactt      1080
     attccttcac cacaagttgc aacctacgat ttgcagcccg aaatgaactc agaaatgctt      1140
     accgacaaac tcgttgcggc aattaaaagc ggcaaatacg acgctattat ttgtaactac      1200
     cctaacggcg atatggtggg tcactctggt gtatttgcag cggcagttaa agcctgcgaa      1260
     gcagttgatc actgtattgg ccgcgtagta gcagcactta acaaatatgg cggtgaagcg      1320
     cttattactg ccgaccatgg taatgctgag caaatggcca accttaaaac aggccaagcc      1380
     catactgcac atactagcga gccggtgcca tttatttatg tgggccgcga cgcaacagca      1440
     tctgagggta aggcgcttag tgatgtagcg cctactatgc tgcacttaat gggcatggag      1500
     cagccaactg aaatgacagg caaacctatc atgacgttga aataa                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page