(data stored in ACNUC7421 zone)

EMBL: CR954246.GPPA

CR954246.GPPA        Location/Qualifiers
FT   CDS_pept        122098..123525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gppA"
FT                   /locus_tag="PSHAa0115"
FT                   /product="Guanosine-5'-triphosphate,3'-diphosphate
FT                   pyrophosphatase (Guanosine pentaphosphate phosphohydrolase)
FT                   (pppGpp-5'-phosphohydrolase)"
FT                   /EC_number="3.6.1.40"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8394006; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85224"
FT                   /db_xref="GOA:Q3IDD5"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDD5"
FT                   /protein_id="CAI85224.1"
FT                   /translation="MLIAKSIAGGLQTIGRVKRKVRLAAGLDIDNVLSSEAMHRGWECL
FT                   ALFAERLQDIPKQNITIVATATLRLASNADVFKAQAEKILGHKVNVISGELEARTIYKG
FT                   VAHTSSCTGSQLVIDIGGASTEVIIGKNFDALLYKSLNIGCVTYLERYFKDCKLSNANF
FT                   NTAIKAARTVIDEIASEYKVKGWQIASGASGTVQAIQEIMIAQNLDELLTLEKLYTIKK
FT                   QSIAYKTIAALDLPGLSEDRRLVFVSGLAILIALFESLEIEKMGLAGGALREGVLYSML
FT                   PELHNSDIRKRTIDGFIDRYHVDQKQASRVASLVLNLASEVNESWPIKALNGLPLLTAV
FT                   AQLHEIGLLIEYKQYHKHSAYILKNTEMPGFSQSEHKVIVAVAKGHRSDLQKGYFDSLG
FT                   ANSVLAQYLVRLIRIAVILCMRRQDDVLPEFAITVKDDVLNLQFENDWLKNHPLMASEL
FT                   QQESKQQAKLGWKLIVN"
     atgcttattg ctaaatcaat agctggcggc ctgcaaacca taggtcgtgt taaacgcaaa        60
     gtaaggttag ctgcagggct tgatatagac aatgtattaa gctcagaagc aatgcataga       120
     ggatgggagt gcctagcgtt atttgctgag cgcttacaag acatccctaa acaaaacatc       180
     actatagttg ccaccgccac attacgttta gctagtaatg ctgatgtatt taaagcgcaa       240
     gcagaaaaaa tcctcggtca taaagttaat gtcattagcg gcgaactaga agcgcgcact       300
     atatataaag gcgttgctca tacctcatct tgcaccggta gtcagcttgt tatcgatatt       360
     ggtggtgcta gcactgaagt gattattggt aagaactttg atgcattact ttacaaaagc       420
     ctgaacatcg ggtgtgttac ctacctagag cgctatttta aagattgcaa attaagcaat       480
     gcaaacttta acaccgcaat aaaagccgca cgtactgtca ttgatgaaat tgcatcagag       540
     tataaagtta aaggctggca aatagcctca ggtgcttcgg gtacagtaca agcaattcaa       600
     gaaatcatga tagcgcaaaa cctagatgag ctattaaccc ttgaaaaact ctacactatc       660
     aaaaagcaat caatcgctta taaaacgatt gccgcattag acctaccagg gctaagtgaa       720
     gatcgccgtt tagtatttgt atcagggctt gccattttaa ttgcattatt tgaatcgctc       780
     gagatcgaaa aaatgggatt agcaggtgga gcactgcgtg agggtgtttt atacagcatg       840
     ctaccagagc tgcataatag cgatattcgt aaacgtacaa tcgatggctt tatcgatcgt       900
     taccatgttg atcaaaagca agctagccgc gtcgccagtc tcgtattaaa cttagcatca       960
     gaagtaaatg aaagctggcc aataaaagca cttaatgggt tgcctttatt aacggcagtt      1020
     gcacagcttc atgaaattgg tttattgata gagtataagc agtatcacaa acacagtgct      1080
     tatattttaa aaaatactga aatgccaggt ttttcgcagt cagagcataa agtcattgtt      1140
     gcggtagcta aagggcatcg ctctgatctt caaaaaggct attttgattc tcttggtgca      1200
     aatagtgtac ttgcgcagta tttagtaaga ctaatacgta tagctgtcat tttatgtatg      1260
     cgtcgccaag atgatgtact ccctgagttt gcgataactg ttaaagacga tgtcttaaat      1320
     ctgcagtttg aaaatgactg gttgaaaaac catccattaa tggcaagcga gctgcaacaa      1380
     gaatctaagc agcaagcgaa acttggctgg aagctcatag taaattaa                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page