(data stored in ACNUC7421 zone)

EMBL: CR954246.GPSA

CR954246.GPSA        Location/Qualifiers
FT   CDS_pept        385843..386850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="PSHAa0370"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD+)"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="1.1.1.94"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9426138; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85468"
FT                   /db_xref="GOA:Q3IIE0"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIE0"
FT                   /protein_id="CAI85468.1"
FT                   /translation="MSTATSAVTVLGAGSYGTALAICLARNGHQVTLWGRNSDDVATLA
FT                   AERKNQRYLPDIPFPDTLTLEADLQRAAASNEIVLVVVPSHAFGDTLKQIKPALQQGAK
FT                   VAWATKGLEPNTGRLLQEVAVQELGDAIPLAVLSGPTFAKEMAMGSPTAISVSSTSTEF
FT                   AQQLADLLHCGRSFRVYNNDDFIGIQLGGAVKNVIAIGAGISDGVGFGANARTALITRG
FT                   LAELTRLGCALGAKPETFMGMAGLGDLILTCTDNQSRNRRFGLALGKGESVEAAIESIG
FT                   QVVEGFRNTKEVYLLAQRSGVEMPITEQIYKVLYENKDMKEAAMALLGREQRSE"
     atgagtacag caacttcagc tgttactgta ttaggggcgg ggtcttatgg caccgccctt        60
     gctatttgct tagcccgaaa tggtcaccaa gtgacacttt gggggcgcaa tagcgacgac       120
     gttgccacgc ttgcagctga gcgaaaaaat caacgttact tacctgacat tccttttccc       180
     gacactttaa ctcttgaagc cgatttacaa cgtgctgcag caagtaatga aatagtgtta       240
     gtggttgtgc ctagtcatgc atttggcgac accttaaagc aaattaaacc tgctttacag       300
     caaggcgcaa aagttgcgtg ggcaactaaa gggctagagc caaataccgg acgcttatta       360
     caagaagttg cagtacaaga gcttggtgat gcaattccat tagcggtgct ttcggggcca       420
     acatttgcta aagaaatggc catgggatca cctactgcta tttcggtttc atccacctct       480
     acagagtttg cacaacagtt agctgattta ctgcattgcg gtcgctcatt tagagtgtac       540
     aacaacgatg attttattgg catacagcta ggtggtgcgg ttaaaaacgt tattgctatt       600
     ggtgcaggca tttccgacgg cgtaggtttt ggcgctaatg cacgcacggc actaattact       660
     cgcggccttg cagaacttac acgcttaggc tgtgctttgg gcgcaaaacc cgaaaccttt       720
     atggggatgg caggccttgg cgatttaatt ttaacctgca cagataatca atcgcgtaat       780
     cgtcgctttg gtttagcgtt aggcaaaggc gaaagcgtag aagctgcaat agagtctata       840
     ggccaagtgg tcgaaggctt cagaaatacc aaagaagtgt atttattagc gcagcgcagc       900
     ggtgtagaaa tgccaatcac cgagcaaatt tataaagtgc tatacgaaaa taaagacatg       960
     aaagaagcgg ctatggcttt attaggccga gagcagcgct cagaataa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page