(data stored in ACNUC7421 zone)

EMBL: CR954246.GROL

CR954246.GROL        Location/Qualifiers
FT   CDS_pept        complement(272763..274406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="PSHAa0259"
FT                   /product="60 kDa chaperonin (Protein Cpn60) (groEL
FT                   protein)"
FT                   /function="1.7 : Cell division"
FT                   /function="3.3.7 : Protein folding"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; PubMedId : 15225312, 15294778;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85358"
FT                   /db_xref="GOA:Q9XAU7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9XAU7"
FT                   /protein_id="CAI85358.1"
FT                   /translation="MAAKEVLFAGDARAKMLTGVNILANAVKVTLGPKGRNVVLDKSFG
FT                   SPVITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVIAAVAELKALSVPCSDTKAIAQVGTISANSDKEIGDIIA
FT                   QAMEKVGRNSGVITVEEGQSLENELDVVEGMQFDRGYLSPYFINSPEKGTVELDNPFIL
FT                   LVDKKISNIRELLPTLEAVAKASKPLLIIAEDLEGEALATLVVNNMRGIVKVSAVKAPG
FT                   FGDRRKAMLQDIAVLTGGTVISEEIGLELEKATVEDLGTAKRVIITKDDTTIIDGAGEE
FT                   AGINGRVSQIKAQIEEATSDYDKEKLQERMAKLAGGVAVIKVGAATEMEMKEKKDRVED
FT                   ALNATRAAVEEGVVPGGGVALVRAASKLVDLVGDNEDQNHGIKVALRAMEAPLRQIVTN
FT                   AGDEASVVINAVKAGSGNFGYNAATGEYNDMIEMGILDPTKVTRSALQFAGSIAGLMIT
FT                   TEAMVAEIPKDDSAPDMGGMGGMGGMGGMM"
     atggcagcaa aagaagtact ttttgcaggt gacgcacgcg ctaaaatgct aactggcgta        60
     aacatcctgg caaacgcagt aaaagttaca ttaggtccta aaggccgtaa cgttgtacta       120
     gataaatcat ttggctctcc agttatcact aaagatggtg tatctgtagc aaaagaaatc       180
     gaacttgaag acaagtttga aaacatgggc gcacaaatgg ttaaagaagt tgcatctaaa       240
     gctaacgatg cagccggcga tggtacaact accgctacag tacttgcaca gtctattgta       300
     aacgaaggcc ttaaagctgt tgcagcaggc atgaacccaa tggaccttaa gcgcggcatc       360
     gacaaagcag taattgctgc tgttgcagag cttaaagcgt tatctgttcc atgctctgac       420
     actaaagcaa ttgcacaagt aggtactatt tcagctaact ctgataaaga gattggcgac       480
     atcattgcac aagcaatgga aaaagtaggc cgtaacagtg gtgttattac tgtagaagaa       540
     ggtcaatcac tagaaaatga actcgatgtt gttgaaggca tgcagtttga ccgtggttac       600
     ctatctcctt actttattaa cagcccagaa aaaggtactg ttgaactaga taacccattt       660
     attctacttg tagataaaaa aatatctaac attcgcgaat tattaccaac attagaagca       720
     gttgctaaag caagcaagcc actactaatc atcgcagaag accttgaagg cgaagcatta       780
     gctacattag tagttaataa catgcgtggt attgttaaag tatcagcagt gaaagctcct       840
     ggttttggcg accgtcgtaa agcaatgcta caagatatcg ctgtattaac tggcggtact       900
     gtgatttcag aagaaatcgg ccttgagctt gaaaaagcaa cagttgaaga cctaggtaca       960
     gctaagcgcg taattatcac taaagatgat acaacaatca ttgatggtgc tggcgaagaa      1020
     gcaggtatta acggccgtgt ttcacaaatt aaagcacaaa tcgaagaagc aacatcagac      1080
     tacgataaag aaaaactaca agagcgcatg gctaaactag ctggcggtgt tgcagtaatc      1140
     aaagttggtg ctgcgactga aatggaaatg aaagagaaaa aagaccgcgt tgaagatgca      1200
     ttaaatgcaa ctcgtgcagc ggttgaagaa ggtgtagtac ctggcggcgg cgttgcacta      1260
     gttcgtgcag caagtaagct ggttgattta gttggcgaca acgaagatca aaaccacggt      1320
     attaaagttg cacttcgtgc aatggaagcg ccacttcgtc aaatcgtaac aaacgcaggt      1380
     gacgaagctt cagttgtaat taacgcagtt aaagcaggtt caggtaactt tggttacaat      1440
     gctgctactg gcgaatacaa tgacatgatt gaaatgggta tcctagatcc aactaaagta      1500
     acacgctctg cactacaatt tgcagggtct attgcgggtc taatgatcac taccgaagct      1560
     atggtagctg aaatccctaa agatgatagc gctcctgata tgggtggcat gggcggtatg      1620
     ggtggaatgg gcggtatgat gtaa                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page