(data stored in ACNUC7421 zone)

EMBL: CR954246.GROS

CR954246.GROS        Location/Qualifiers
FT   CDS_pept        complement(274455..274742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="PSHAa0260"
FT                   /product="10 kDa chaperonin (Protein Cpn10) (groES
FT                   protein)"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85359"
FT                   /db_xref="GOA:Q9AKT2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AKT2"
FT                   /protein_id="CAI85359.1"
FT                   /translation="MNIRPLHDRVIVKRLEEETKSAGGIVLTGSAAEKSTRGEVVAVGN
FT                   GRILESGDVRALEVKAGDTVLFGSYVEKVEKIEGQEYLIMREDNILGIVG"
     atgaatattc gtcctttaca tgatcgcgtg atcgttaagc gtctagaaga agaaacaaaa        60
     tctgctggcg gtattgtatt aactggctct gcagctgaaa aatcaacccg cggagaagtt       120
     gttgccgttg gtaatggtcg cattttagaa agcggtgatg ttagagcatt agaagttaaa       180
     gccggtgaca cagtgttatt tggctcatat gttgagaaag ttgaaaagat cgaaggtcaa       240
     gagtacctga tcatgcgtga agataatatt ttaggcattg taggctaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page