(data stored in ACNUC7421 zone)

EMBL: CR954246.GSPC

CR954246.GSPC        Location/Qualifiers
FT   CDS_pept        244836..245777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="PSHAa0231"
FT                   /product="putative general secretion pathway protein C"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85334"
FT                   /db_xref="GOA:Q3ILN1"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN1"
FT                   /protein_id="CAI85334.1"
FT                   /translation="MEQQVQQFKHFISRLPHAKLSAVVTLLVVVYIAFLSSKLVWLMWP
FT                   NPIVSPLTPIYYGQHSTAASNNYSQHIIEQFIFGKIIVKSKSDDHAAKVVNDAPETRLS
FT                   INLTGIVAVNNDDKAGLAIIESQGKQETYLVDEAVQGTRAKLAQILPDRVILTVNGRFE
FT                   TLMLDGLDFTKTVSMPVLAARDEAEMGPQLGPAPSEQQIDVTADPNIKQALIETREELL
FT                   EEPGKLFDYIRVSQAMSDGELIGYRLSPGKEPELFKQMGLQNNDLAVAINGYQLTDLKQ
FT                   AMAAINELRNSTDATITIERDNQQIDVQFSLQ"
     atggaacagc aagttcaaca atttaaacat tttataagcc gtttaccgca tgccaaattg        60
     agtgcggttg ttacattatt agttgttgtt tatattgctt ttttatcgtc taaactcgtt       120
     tggcttatgt ggccaaatcc tattgtgtca ccactgacgc caatctacta cggacaacat       180
     tcaactgcag caagtaacaa ttattctcaa catataattg agcaatttat atttggtaaa       240
     ataattgtta aaagcaagag cgatgatcac gctgcgaaag ttgttaatga tgcccctgaa       300
     acgcgcttaa gtattaatct tactggtatt gtagcggtaa ataacgacga taaagcgggg       360
     ctcgctatta tagagtcaca gggcaagcaa gaaacctacc tagtagatga agcagtgcaa       420
     gggacgcgag ctaaactagc gcagatatta cctgaccgcg ttattttaac ggtaaacgga       480
     cgatttgaaa cattaatgtt agatggtctc gactttacaa aaacagtatc tatgccggtt       540
     ttagctgcac gtgatgaagc tgaaatgggc ccacaattag ggcctgcccc aagtgagcaa       600
     caaatagatg taactgccga tccaaacatt aagcaggctt taatcgaaac ccgtgaagag       660
     ttgctcgaag agcccggtaa gttatttgac tatattcgcg tgtcacaagc gatgagcgat       720
     ggggaactta ttggttatcg cttgagtcca ggtaaagagc ctgagctatt taagcagatg       780
     ggattacaaa ataacgattt agctgttgca attaatggct atcaactaac agatttaaaa       840
     caggccatgg cagccattaa tgagctgcgt aacagtacag atgccactat cactattgaa       900
     cgtgataacc agcaaataga cgtacaattt agtctgcaat aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page